Recombinant Human Pou Domain, Class 5, Transcription Factor 1 (POU5F1) Protein (His-B2M)

Name: Recombinant Human Pou Domain, Class 5, Transcription Factor 1 (POU5F1) Protein (His-B2M)
Brand: Beta LifeScience
SKU: BLC-03507P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Fc receptors, Other recombinant proteins, Recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Pou Domain, Class 5, Transcription Factor 1 (POU5F1) Protein (His-B2M) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q01860
Target Symbol	POU5F1
Synonyms	Octamer binding transcription factor 4; MGC22487; Oct 3; Oct 4; Oct-3; Oct-4; OCT3; Oct4; Octamer binding protein 3; Octamer binding protein 4; Octamer binding transcription factor 3; Octamer-binding protein 3; Octamer-binding protein 4; Octamer-binding transcription factor 3; OTF 3; OTF 4; OTF-3; OTF3; OTF4; PO5F1_HUMAN; POU class 5 homeobox 1; POU domain class 5 transcription factor 1; POU domain transcription factor OCT4; POU domain, class 5, transcription factor 1; POU-type homeodomain-containing DNA-binding protein; POU5F1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-B2M
Target Protein Sequence	MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
Expression Range	1-360aa
Protein Length	Full Length
Mol. Weight	52.6kDa
Research Area	Epigenetics And Nuclear Signaling
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Forms a trimeric complex with SOX2 or SOX15 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency.
Subcellular Location	Cytoplasm. Nucleus.
Protein Families	POU transcription factor family, Class-5 subfamily
Database References	HGNC: 9221 OMIM: 164177 KEGG: hsa:5460 STRING: 9606.ENSP00000259915 UniGene: Hs.249184
Tissue Specificity	Expressed in developing brain. Highest levels found in specific cell layers of the cortex, the olfactory bulb, the hippocampus and the cerebellum. Low levels of expression in adult tissues.

Gene Functions References

Study established a relationship between OCT4 and SMAD3 heterodimers formation and Snail, Slug, and CXCL13 transcription promotion mediating breast cancer progression. PMID: 29526821
Metastatic double primary endometrioid endometrial and ovarian carcinoma sections expressed a higher level of OCT4 compared to the corresponding DPEEOC tissues. PMID: 29569698
Cripto-1 expression is increased by OCT4 overexpression, but decreased by shRNA-mediated OCT4 knockdown. OCT4 overexpression significantly activates Cripto-1 transcriptional activity. A 5'-upstream minimal promoter sequence in the gene-encoding Cripto-1 is significantly activated by OCT4 overexpression. PMID: 29223130
Multivariate Cox's proportional hazards regression analyses revealed that OCT4 mRNA high expression was an independent predictive factor for shorter EFS and OS in AML patients. Conclusion OCT4 correlates with presence of CK, FLT3-ITD mutation and poorer risk stratification, and it could be served as a convincing biomarker for predicting unfavourable prognosis in AML patients. PMID: 29950146
GCNF acts as a transcriptional repressor in the regulation of OCT4 gene expression through cooperative interaction with three NR binding elements in pluripotent NCCIT cells. PMID: 29057499
Study shows that irrespective of tumor type or clinicopathological status, breast cancer cells expressed high levels of Oct3/4 at mRNA and protein levels. PMID: 29620155
Tumor tissue OCT4 expression was positively correlated with histologic grade, pathological tumor size and prognosis in surgical patients with triple-negative breast cancer. PMID: 29536377
Radiation resistance tumors have upregulated Onzin and POU5F1 expression. PMID: 29596836
verification of the presence of stem cell-like cells in the epithelial component through the immunopositivity to Oct-4 and CD44 in benign odontogenic lesions of variable biological behaviors PMID: 29971493
Oct4 plays a vital role in the malignant progression of HCC cells through the survivin/STAT3 signaling pathway. PMID: 29901157
Secretome analysis revealed that Oct4 upregulated interleukin 24 (IL24) expression through STAT3 and NFkappaB signaling, and siRNA against IL24 increased IRinduced senescence, whereas recombinant human IL24 suppressed it. The results of the present study indicated that Oct4 confers IR resistance on breast cancer cells by suppressing IRinduced premature senescence through STAT3- and NFkappaB-mediated IL24 production. PMID: 29749438
BEX4 positively regulated the expression of OCT4, silencing of which reduced the proliferation of A549 and H1975cells with over-expressed BEX4. PMID: 29660335
Oct4 transcriptionally activates NEAT1 via promoter and MALAT1 via enhancer binding to promote cell proliferation and motility, and led to lung tumorigenesis and poor prognosis. PMID: 28615056
POU5F1 expression is suggested to be a prognostic factor in patients with colorectal cancer. PMID: 29488015
that OCT4 is implicated in the differentiation arrest at least in some types of acute myeloid leukemia PMID: 28911263
Overexpressed TWIST1 can be correlated with upregulation of the cancer stem cell marker OCT4 and the protein may play critical regulatory role in OCT4 gene expression. PMID: 29299035
rs2394882 in cancer stem cells gene POU5F1 is associated with prostate cancer recurrence. PMID: 29104488
The emerging roles of OCT4 in coordinating the cell cycle progression, the maintenance of pluripotency and the glycolytic metabolism in embryonic stem cells have been discussed. (Review) PMID: 28901500
Link between embryonic stem cell pluripotency and homologous allelic pairing of Oct4 loci. PMID: 28967672
Chicken egg-white extracts promote OCT4 and NANOG expression and telomeres growth in 293T cells. PMID: 28838341
OCT4 and SOX2 work as transcriptional activators in reprogramming human fibroblasts. PMID: 28813671
Low expressions of Oct4-EpCAM in IHC and CD133 in qPCR may reveal roles in gastric cancer PMID: 27557490
The prevalence of Oct-3/4 and D2-40-positive staining of germ cells in testicular biopsies of boys with cryptorchidism were in age groups less than 6 months, 100% and 50%; 6-12 months, 60% and 17%; and 1-2 years, 12% and 4%. In all cases, the Oct-3/4 and D2-40 positive germ cells turned negative and the histological pattern normalized completely with age. PMID: 27606906
Our results indicate that Oct4 expression is associated with aggressive features, ALDH1 expression, tamoxifen resistance and poor clinical outcomes in hormone receptor-positive breast cancer, and thus may be useful as a predictive and prognostic marker in this subgroup of breast cancer. PMID: 28422735
Rectal tumor tissue OCT4 (p<0.001), SOX2 (p=0.003), and NANOG (p<0.001) expressions were higher than those in adjacent tissue. PMID: 29214774
Novel spliced variants of OCT4, OCT4C and OCT4C1, with distinct expression patterns and functions in pluripotent and tumor cell lines have been described. PMID: 28476334
we have provided evidence that Oct4 expression is enhanced in bladder cancer cells after treatment with various chemotherapeutic agents, rendering bladder cancer chemoresistant. PMID: 27244887
our study describes the relationship between ABCG2 and OCT-4 expression and the clinicopathological characteristics of RCC patients. ABCG2 and OCT-4 expression was significantly correlated with RCC recurrence, which has a poor prognosis. PMID: 28212529
we confirmed that up-regulated KPNA2 and OCT4 expression is a common feature of bladder cancer that is correlated with increased aggressive tumor behavior. Also, we propose that KPNA2 regulates the process of OCT4 nuclear transportation in bladder cancer. PMID: 27611951
Knockdown of OCT4 in NSCLC cells could decrease cell proliferation, and potentiate apoptosis induced by gefitinib, suggesting OCT4 may contribute to gefitinib resistance in NSCLC. PMID: 27816965
Data show that lung adenocarcinoma SPC-A1 cell differentiated by a two-stage induction (TSI) method lost stem cell characteristics, including absent expression of OCT4 and Nanog. PMID: 27588392
Overexpression of OCT4 is associated with neoplasms. PMID: 28235715
The survival rate was increased by 11.1% in Oct4/Sox2-hAT-MSC-injected mice. PMID: 28438862
OCT4B1 plays an essential role in inflammation and apoptosis of dental pulp cells . OCT4B might operate synergistically with OCT4B1 to reduce apoptosis. PMID: 28473980
OCT4 is over-expressed in both of the breast cancer cell lines; MCF7 and MDA-MB-231 and its inhibition resulted in drastic decrease in rate of cell proliferation, metastatic ability and induced apoptosis. PMID: 29203199
The positive feedback regulation of OCT4 and c-JUN, resulting in the continuous expression of oncogenes such as c-JUN, seems to play a critical role in the determination of the cell fate decision from induced pluripotent stem cells to cancer stem cells in liver cancer. PMID: 27341307
MACC1-induced tumor progression in colorectal cancer acts, at least in part, via the newly discovered MACC1/Nanog/Oct4 axis. PMID: 26758557
Lymphatic/vascular invasion (LVI) in the spermatic cord of patients with pure seminoma may be obscured by prominent lymphohistiocytic inflammation (LHI), and staining of such foci with OCT4 may increase the detection of LVI by 45%. PMID: 27020494
The findings of this study suggested that Oct4B1 has a potential role in tumorigenesis of brain cancer and can be considered as a new tumor marker with potential value in diagnosis and treatment of brain cancer. PMID: 27585657
High OCT4 expression is associated with enhancement of angiogenesis in lung cancer. PMID: 26871601
Logistic regression analysis revealed that OCT4 rs1265163 showed the most significant association signal for the risk of chronic hepatitis B (CHB). Linkage disequilibrium and conditional analysis confirmed rs1265163 in OCT4 as a novel genetic marker for CHB susceptibility. PMID: 27596359
the pluripotency transcription factor OCT4 can serve as a metabolic-redox sensor in human embryonic stem cells and that metabolic cues can act in concert with growth factor signaling to orchestrate stem cell differentiation. PMID: 27346346
High OCT4 expression is associated with brain neoplasms. PMID: 28933914
The quadruplex acts as a strong, positive regulator of Oct4 expression. PMID: 27863263
these findings demonstrated that HIF-2alpha in vselMSCs cooperated with Oct4 in survival and function. The identification of the cooperation between HIF-2alpha and Oct4 will lead to deeper characterization of the downstream targets of this interaction in vselMSCs and will have novel pathophysiological implications for the repair of infarcted myocardium. PMID: 28079892
gene editing reveals a role for OCT4 in human embryogenesis PMID: 28953884
we are reporting a new variant of OCT4, which is expressed under different physiological conditions. The finding shed more light on complexity of OCT4 expression and functions. PMID: 29022482
High Oct4 expression is associated with breast cancer. PMID: 28423536
The expression of Oct4A may be crucial to promote and sustain integrin-mediated extracellular matrix (ECM) remodeling requisite for tumor metastasis in ovarian cancer patients. PMID: 27390927
High OCT4A expression is associated with metastasis in medulloblastoma . PMID: 28186969

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.