Recombinant Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) ptxA Protein (N-6xHis-B2M)
Beta LifeScience
SKU/CAT #: BLC-11427P

Greater than 85% as determined by SDS-PAGE.
Recombinant Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) ptxA Protein (N-6xHis-B2M)
Beta LifeScience
SKU/CAT #: BLC-11427P
Regular price
$94900
$949.00
Sale price$29900
$299.00Save $650
/
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P04977 |
Target Symbol | ptxA |
Species | Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) |
Expression System | E.coli |
Tag | N-terminal 6xHis-B2M-tagged |
Target Protein Sequence | DDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF |
Expression Range | 35-269aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 40.8 |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Function | S1 is an NAD-dependent ADP-ribosyltransferase, which plays a crucial role in the pathogenesis of B.pertussis causing disruption of normal host cellular regulation. It catalyzes the ADP-ribosylation of a cysteine in the alpha subunit of host heterotrimeric G proteins. In the absence of G proteins it also catalyzes the cleavage of NAD(+) into ADP-ribose and nicotinamide. It irreversibly uncouples the G-alpha GTP-binding proteins from their membrane receptors. |
Subcellular Location | Secreted. Note=The individual chains are secreted by a sec-dependent mechanism into the periplasm. Then, S1 associates with the outer membrane before it joins with the B subunit to form the secretion-competent holotoxin. The type IV secretion system ptl mediates secretion of assembled toxin through the outer membrane. |
Protein Families | Bacterial exotoxin subunit A family |
Database References |
KEGG: bpe:BP3783 STRING: 257313.BP3783 |