Biotinylated Recombinant Human Blood group Rh (RHD) Protein (MBP&His-Avi)
Beta LifeScience
SKU/CAT #: BLC-07546P

Greater than 85% as determined by SDS-PAGE.
Biotinylated Recombinant Human Blood group Rh (RHD) Protein (MBP&His-Avi)
Beta LifeScience
SKU/CAT #: BLC-07546P
Regular price
$74400
$744.00
Sale price$34900
$349.00Save $395
/
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Description | Biotinylated Recombinant Human Blood group Rh (RHD) Protein (MBP&His-Avi) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q02161 |
Target Symbol | RHD |
Synonyms | (RHXIII)(Rh polypeptide 2)(RhPII)(Rhesus D antigen)(CD antigen CD240D) |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-MBP&C-6His-Avi |
Target Protein Sequence | LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF |
Expression Range | 388-417aa |
Protein Length | Partial |
Mol. Weight | 51.4 kDa |
Research Area | Cardiovascular |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane. |
Subcellular Location | Cell membrane; Multi-pass membrane protein. |
Protein Families | Ammonium transporter (TC 2.A.49) family, Rh subfamily |
Database References | |
Tissue Specificity | Restricted to tissues or cell lines expressing erythroid characters. |
Gene Functions References
- 4 novel RHD alleles, each characterized by a single nucleotide substitution were identified. RHD*67T, RHD*173T, and RHD*579C give rise to a weak D phenotypical expression. Their corresponding amino acid changes are predicted to be located in the membrane-spanning or intracellular domains of the RhD protein. RHD*482G is the 4th substitution. PMID: 29052223
- Extensive studies show that the RHD*1227A is the most prevalent DEL allele in East Asian populations and may have confounded the initial molecular studies. PMID: 29214630
- The most prevalent DEL allele was RHD*DEL1 (c.1227G>A), which is proven to be immunogenic. A high frequency of RHD*Psi was detected in the donors with nondeleted RHD alleles (31%), far superior to the frequency of RHD variant alleles (15.5%). PMID: 29193119
- Absence of the whole RHD gene is common among RhD negative blood donors from Qingdao region, and there are rich genetic polymorphisms for this locus PMID: 29188626
- The RHD 1227G>A mutation contributes to the molecular basis of Del phenotype in the Taiwanese population. The point mutation results in aberrant frame shift or exon deletion transcripts and generates D protein with weak antigen presenting function. PMID: 26774048
- In this mixed Brazilian population, the most frequent weak D types were 1, 4, 3 and 2 (frequencies of 4.35%, 2.32%, 1.46% and 0.29%, respectively; total of 8.41%) and partial D was found in 2.90% of samples carrying the RHD gene. For samples with inconclusive RhD typing, 53.33% of them presented weak and partial RHD, and 43.75% had concomitantly more than one RHD variant PMID: 27184292
- sequence comparisons revealed high sequence similarity between Patr_RHbeta and Hosa_RHCE, while the chimpanzee Rh gene closest to Hosa_RHD was not Patr_RHa but rather Patr_RHy PMID: 26872772
- Six weak D types in the Russian Federation: the most common type 3 (49.2%) and type 1 (28.6%), type 2 (14.3), type 15 (4.8%), type 4.2 (DAR) (1.6%) and type 6 (1.6%). PMID: 27459619
- The frequency of RhD negative homozygosity in the Cypriot population was estimated to be 7.2%, while the frequencies of RHD hemizygosity and RhD positive homozygosity was calculated to be 39.2 and 53.6%, respectively. PMID: 27036548
- Occurrence of partial RhD alleles in the Tunisian population. PMID: 26482434
- Reduced expression of D antigen is caused not only by missense mutation of the RHD gene, but also by silent mutation that may affect splicing. PMID: 26340140
- Loss of heterozygosity of RhD gene on chromosome 1p in acute myeloid leukemia. PMID: 25495174
- The data indicate that partial DEL women appear at risk of alloimmunization to the D antigen. PMID: 26033335
- Weak D type 4.0 appears to be the most prevalent weak D in our population. However, all samples must be sequenced in order to determine the exact subtype of weak D type 4, since weak D type 4.2 has considerable clinical importance PMID: 25369614
- Paternal RHD zygosity determination in Tunisians: evaluation of three molecular tests. PMID: 24960665
- Serologic findings of RhD alleles in Egyptians and their clinical implications. PMID: 25219636
- Despite the enormous diversity of RHD alleles, first-line weak D genotyping was remarkably informative, allowing for rapid classification of most samples with conspicuous RhD phenotype in Flanders, Belgium. PMID: 25413499
- Splicing is altered in RHD*weak D Type 2 allele, a rare variant most commonly found in Caucasians; RHD including the full-length Exon 9 is transcribed in the presence of the c.1227G>A substitution frequently carried by Asians with DEL phenotype. PMID: 25808592
- Among all donors 89.00% and 10.86% were D-positive and D-negative, respectively, while 0.14% (n=55) of the donors were found to be weak D-positive. PMID: 24960662
- The frequency of D variants detected by IAT allele RHD(M295I) was 1:272 in D negative donors. Obviously, DEL phenotype is more common in some parts of European population than initially thought. PMID: 24556127
- New RHD variant alleles. PMID: 25179760
- Currently, it seems to be difficult to observe any new RHD alleles in the Han Chinese population. D prediction in this population is easier because popular alleles are dominant, accounting for about 99.80% of alleles in D-negative people. PMID: 24333088
- In Han Chinese people with weak D serotyping, 8 weak D and 4 partial D alleles were found. 3 new weak D alleles (RHD weak D 95A, 779G, and 670G) and one new partial D allele (RHD130-132 del TCT) were identified. PMID: 25070883
- DEL/weak D-associated RHD alleles were found in 2.17% of Australian D-, C+ and/or E+ blood donors. PMID: 24894016
- RHD alleles and D antigen density among serologically D- C+ Brazilian blood donors. PMID: 24267268
- In this study, D antigen density on the erythrocyte surface of DEL individuals carrying the RHD1227A allele was extremely low, there being only very few antigenic molecules per cell, but the D antigen epitopes were grossly complete. PMID: 24333082
- The prevalence of D-/RHD+ samples is higher than that observed in Europeans. More than 50% of the RHD alleles found were represented by RHDpsi and RHD-CE-D(s) showing the African contribution to the genetic pool of the admixed population analyzed. PMID: 24819281
- A method of genotyping has been developed in the laboratory. genotyping results of 200 pregnant women have been compared with RH1 phenotype at birth. PMID: 24559796
- We conclude that noninvasive fetal RHD genotyping from maternal blood provides accurate results and suggests its viability as a clinical tool for the management of RhD-negative pregnant women in an admixed population. PMID: 24615044
- Two molecular polymorphisms to detect the (C)ce(s) type 1 haplotype. PMID: 24333080
- This study analyzes the phenotype and frequency of RhD and tetanus toxoid specific memory B cells in limiting dilution culture. PMID: 24965774
- Data indicate that non-invasive prenatal testing of cell-free fetal DNA (cffDNA) in maternal plasma can predict the fetal RhD type in D negative pregnant women. PMID: 24204719
- DIV alleles arose from at least two independent evolutionary events. DIV Type 1.0 with DIVa phenotype belongs to the oldest extant human RHD alleles. DIV Type 2 to Type 5 with DIVb phenotype arose from more recent gene conversions. PMID: 23461862
- RHD*DARA and RHD*DAR2 are the same allele. Furthermore, the alleles RHD*DAR1.2 and RHD*DAR1.3 both exist; however, the silent mutation 957G>A (V319) showed no influence on the RhD phenotype. PMID: 23902153
- All novel weak D types expressed all tested D epitopes. PMID: 23550956
- Only 0.2% of D- Polish donors carry some fragments of the RHD gene; all of them were C or E+. Almost 60% of the detected RHD alleles may be potentially immunogenic when transfused to a D- recipient. PMID: 23634715
- This study is the first to describe weak D types caused by intronic variations near the splice sites in the RHD gene, which is supported by the genotyping results combined with serologic profiles and bioinformatics analysis. PMID: 23216299
- RHD variants were identified in 91.6% of the 430 studied samples. Two of the nine previously undescribed variants, c.335G>T and c.939G>A, were found to cause aberrant mRNA splicing by means of a splicing minigene assay. PMID: 23228153
- Hemizygous RHD subjects demonstrated significantly higher platelet increases and peak platelet counts than homozygous RHD subjects. PMID: 23712954
- The RHD*weak 4.3 allele with markedly reduced antigen D expression was shown to be associated with an altered RHCE gene formation leading to the expression of C(X) and VS. PMID: 22288371
- modulates the influence not only of latent toxoplasmosis, but also of at least two other potentially detrimental factors, age and smoking, on human behavior and physiology. PMID: 23209579
- RHD*DIVa and RHCE*ceTI almost always, but not invariably, travel together. This haplotype is found in people of African ancestry and the red blood cells can demonstrate aberrant reactivity with anti-C. PMID: 22804620
- RHD*DOL2, like RHD*DOL1, encodes a partial D antigen and the low-prevalence antigen DAK. PMID: 22738288
- The use of cell-free fetal DNA in prenatal noninvasive early detection of fetal RhD status and gender by real-time PCR is highly sensitive and accurate as early as the 11th week of gestation for RhD status and the 7th week of gestation for fetal sex. PMID: 21488716
- This deletion appears to represent not only the first large deletion associated with weak D but also the weakest of weak D alleles so far reported. PMID: 22420867
- Characterization of novel RHD alleles. PMID: 22320258
- The RHD genotyping proved to be a necessary tool to characterise RHD alleles in donors phenotyped as D- or weak D to increase the transfusion safety in highly racial mixed population. PMID: 22211984
- RHD homozygotes had nearly twice as many D antigen sites as hemizygotes. Expression of c or E antigens was associated with increased RBC D antigen expression, but presence of C or e antigens reduced expression. PMID: 22121029
- Anti-D investigations in individuals expressing weak D Type 1 or weak D Type 2 PMID: 21658048
- Distribution of weak D types in the Croatian population. PMID: 21269342