Biotinylated Recombinant Human C-C Motif Chemokine 1 (CCL1) Protein (MBP&His-Avi)
Beta LifeScience
SKU/CAT #: BLC-07431P

Greater than 85% as determined by SDS-PAGE.
Biotinylated Recombinant Human C-C Motif Chemokine 1 (CCL1) Protein (MBP&His-Avi)
Beta LifeScience
SKU/CAT #: BLC-07431P
Collections: Avi-tagged proteins, Biotinylated proteins, Buy cytokines, chemokines, and growth factors for research online, Chemokines and receptors – essential regulators of immune response, Cytokines, Featured biotinylated protein molecules, High-quality recombinant proteins, Recombinant proteins fall special offers - full-length proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Biotinylated Recombinant Human C-C Motif Chemokine 1 (CCL1) Protein (MBP&His-Avi) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P22362 |
Target Symbol | CCL1 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-MBP&C-6His-Avi |
Target Protein Sequence | KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK |
Expression Range | 24-96aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 56.3 kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Cytokine that is chemotactic for monocytes but not for neutrophils. Binds to CCR8. |
Subcellular Location | Secreted. |
Protein Families | Intercrine beta (chemokine CC) family |
Database References |
Gene Functions References
- Chemokine (C-C motif) ligand 1 ( CCL1) is preferentially Plasma levels of CCL1 were significantly higher in patients with HAM/TSP. Minocycline inhibited the production of CCL1 in HTLV-1-infected T-cell lines. PMID: 29202792
- downregulation of miR-20a-5p is caused by promoter hypermethylation. MiR-20a-5p could also suppress the production of IL-17 by targeting OSM and CCL1 production in CD4(+) T cells in patients with active VKH. PMID: 28972028
- was to evaluate the possible association between CCL1 rs2072069 G/A or/and TLR2 rs3804099 T/C (T597C) polymorphisms and pulmonary tuberculosis (PTB) or/and tuberculous meningitis (TBM) in a sample of the Chinese adult population PMID: 26722451
- The results of the present study demonstrated that GAS5 was able to suppress bladder cancer cell proliferation, at least partially, by suppressing the expression of CCL1. PMID: 26548923
- CCL1-CCR8 interaction may play a critical role in lymphocytic recruitment in IgG4-related sclerosing cholangitis and type 1 autoimmune pancreatitis, leading to duct-centred inflammation and obliterative phlebitis. PMID: 23811304
- CCL1 is an antimicrobial protein with bacteriocidal activity against E. coli and S. aureus. PMID: 12949249
- These data identify a novel function for CCL1-CCR8 in metastasis and lymph node LECs as a critical checkpoint for the entry of metastases into the lymph nodes. PMID: 23878309
- CCL1, CCL26, and IgE may be associated with pruritus in cutaneous T-cell lymphoma. PMID: 22948508
- C-terminal clipping of chemokine CCL1/I-309 enhances CCR8-mediated intracellular calcium release and anti-apoptotic activity PMID: 22479563
- There was a borderline association between a single nucleotide polymorphism located within the CCL1 gene and predisposition to tuberculosis using a singlepoint analysis PMID: 22147355
- ACEI is effective in downregulating LPS-induced TNF-alpha, I-309, and IP-10, which play important roles in the pathogenesis of inflammation PMID: 21849907
- After stimulation via high-affinity FcepsilonRI, the transcriptional levels of I-309 (CCL1), MIP-1alpha (CCL3) and MIP-1beta (CCL4) were found among the 10 most increased human and mouse transcripts from approximately 12 000 genes PMID: 12393595
- Transfected human CCL1 up-regulated ERK1/2 MAPK phosphorylation in BW5147 cells. CCL1 activates the MAPK pathway in CCR8-transfected CHO cells. PMID: 12645948
- the axis CCL1-CCR8 links adaptive and innate immune functions that play a role in the initiation and amplification of atopic skin inflammation PMID: 15814739
- CC chemokine ligand 1 may play a role in lymphocyte recruitment in bronchial asthma PMID: 16540498
- Benzo(a)pyrene and an aryl hydrocarbon receptor agonist enhance activitity of te Ccl1 promoter. PMID: 16679317
- Thus, CCL1 is a CC chemokine with a unique pattern of regulation associated with a distinct form of M2 (Type 2, M2b) monocyte activation, which participates in macrophage-dependent regulatory circuits of innate and adaptive immunity. PMID: 16735693
- Variants in the CCL1 gene are associated with susceptibility to AEs through their potential implication in the host defense mechanisms against AEs. PMID: 16864713
- The mechanisms underlying the mast cell-CD4-positive T lymphocyte axis is determined by mast cell-derived CCL1 and a subset of CD4-positive T cells expressing CCR8. PMID: 17641040
- The combination of 17beta-E(2) with the environmental pollutant TCDD is involved in the pathogenesis of endometriosis via up-regulating the chemokine CCR8-I-309. PMID: 17693327
- 6 single nucleotide polymorphisms in CCL1 were found to be associated with tuberculosis in a case-control genetic association study with 273 TB cases and 188 controls PMID: 19057661
- serum CCL1 levels were slightly, but statistically significantly, correlated with serum IgE levels in patients with bullous pemphigoid. PMID: 19117730
- The authors show here that PRV-gG binds to the human chemokine CL1 and several CC and CXC human chemokines with high affinity. PMID: 19776237