Recombinant Human PRL-1 Protein
Beta LifeScience
SKU/CAT #: BLA-1755P
Recombinant Human PRL-1 Protein
Beta LifeScience
SKU/CAT #: BLA-1755P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q93096 |
Synonym | HH 72 HH72 Hypothetical protein DKFZp779M0721 Phosphatase of regenerating liver 1 PRL 1 PRL-1 PRL1 Protein tyrosine phosphatase PTPCAAX1 Protein tyrosine phosphatase type IVA 1 Protein tyrosine phosphatase type IVA member 1 Protein-tyrosine phosphatase 4a1 Protein-tyrosine phosphatase of regenerating liver 1 Protein-tyrosine phosphatase, type 4A, 1 PTP(CAAXI) Ptp4a1 PTPCAAX1 TP4A1_HUMAN |
Description | Recombinant Human PRL-1 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMARMNRPAPVEVTYKNMRFLITHNPTNATL NKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQI VDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAV QFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNC |
Molecular Weight | 22 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |