Recombinant Human RBP1 Protein
Beta LifeScience
SKU/CAT #: BLA-1777P
Recombinant Human RBP1 Protein
Beta LifeScience
SKU/CAT #: BLA-1777P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P09455 |
Synonym | Cellular retinol binding protein Cellular retinol-binding protein Cellular retinol-binding protein I CRABP I CRBP CRBP-I CRBP1 CRBPI RBP 1 RBP1 RBPC RET1_HUMAN Retinol binding protein 1 cellular Retinol-binding protein 1 |
Description | Recombinant Human RBP1 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMDPPAGFVRAGNPAVAAPQSPLSPEGA HFRAAHHPRSTGSRCPGSLQPSRPLVANWLQSLPEMPVDFTGYWKMLVNE NFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDF QVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDE LHLEMRVEGVVCKQVFKKVQ |
Molecular Weight | 25 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |