Recombinant Human Retinol-Binding Protein 4 (RBP4) Protein (hFc), Active

Name: Recombinant Human Retinol-Binding Protein 4 (RBP4) Protein (hFc), Active
Brand: Beta LifeScience
SKU: BLC-05849P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Activity Measured by its binding ability in a functional ELISA. Immobilized RBP4 at 5 μg/ml can bind TTR , the EC 50 is 695.0-970.1 ng/ml. Biological Activity Assay

The purity of RBP4 was greater than 90% as determined by SEC-HPLC.

Collections: Cytokines, Cytokines and growth factors, Growth factors and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Retinol-Binding Protein 4 (RBP4) Protein (hFc), Active is produced by our Mammalian cell expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE and HPLC.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Activity	1. Measured by its binding ability in a functional ELISA. Immobilized RBP4 at 5 μg/ml can bind TTR , the EC 50 is 695.0-970.1 ng/ml.
Uniprotkb	P02753
Target Symbol	RBP4
Synonyms	(Plasma retinol-binding protein)(PRBP)(RBP)
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-hFc
Target Protein Sequence	ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Expression Range	19-201aa
Protein Length	Full Length of Mature Protein
Mol. Weight	50.0 kDa
Research Area	Cancer
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Retinol-binding protein that mediates retinol transport in blood plasma. Delivers retinol from the liver stores to the peripheral tissues. Transfers the bound all-trans retinol to STRA6, that then facilitates retinol transport across the cell membrane.
Subcellular Location	Secreted.
Protein Families	Calycin superfamily, Lipocalin family
Database References	HGNC: 9922 OMIM: 180250 KEGG: hsa:5950 STRING: 9606.ENSP00000360519 UniGene: Hs.50223
Associated Diseases	Retinal dystrophy, iris coloboma, and comedogenic acne syndrome (RDCCAS); Microphthalmia, isolated, with coloboma, 10 (MCOPCB10)
Tissue Specificity	Detected in blood plasma and in urine (at protein level).

Gene Functions References

Baseline RBP4 levels and MELD scores predicted 21-day ( /=25) mortality, respectively. In critically ill patients with underlying liver disease, with a link to eGFRs, INRs and TC levels, the baseline RBP4 may serve as a marker for short-term mortality. PMID: 28588245
our study provides clinical evidence revealing that the serum concentrations of RBP4 were elevated in NAFLD patients in a Chinese population. These findings indicated that RBP4 might be a noninvasive molecular biomarker that detects the presence of NAFLD in middle-aged and elderly population. PMID: 28332619
Vitreous levels of APOA1 and RBP4 in human rhegmatogenous retinal detachment associated with choroidal detachment reflects the severity of disease. PMID: 29618920
The overexpression of RBP4 increased cell proliferation, whereas siRNA-mediated RBP4 knockdown significantly decreased HTR8/SVneo cell proliferation via activation of PI3K/AKT signaling. PMID: 30015949
High RBP4 expression is associated with hypertriglyceridemia. PMID: 29747616
We observed that knockdown of RBP4 can greatly suppress ovarian cancer cell migration and proliferation. PMID: 29642915
This study showed that the Levels of circulating RBP4 was significantly higher in Chronic Kidney Disease than in control. PMID: 29678848
Our results demonstrate that IR is associated with high circulating RBP4 and that suppressed RBP4 adipose tissue expression is accompanied by reduced GLUT4 expression in HD. Renal transplantation or HDF are effective in lowering serum RBP4 levels. PMID: 29333450
Data suggest that serum levels of RBP4 and LGAL3BP are up-regulated after menopause when complicated by NAFLD (non-alcoholic fatty liver disease); RBP4 and LGAL3BP may serve as biomarkers of NAFLD in postmenopausal women. (RBP4 = retinol binding protein 4; LGAL3BP = galectin-3 binding protein) PMID: 29679552
Elevated levels of RBP4 were not associated with an increased risk of ischemic stroke among women. PMID: 28888344
Study showed that dietary weight loss-induced changes in angiotensin-converting enzyme activity, free fatty acids and RBP4 independently contribute to weight regain prediction. PMID: 29122953
RBP4 is involved in all-trans retinoic acid-induced cleft palate. PMID: 28849085
the 1.5A resolution structures of human holo-RBP4 and of the protein saturated with palmitic and lauric acid and discuss the interaction of the fatty acids and retinol with the protein, are reported. PMID: 29414511
Circulating RBP4 levels may not be associated with nonalcoholic fatty liver disease. PMID: 28931435
Plasma PEDF and RBP4 identified insulin resistance in subjects with no prior diagnosis of diabetes. PMID: 28648555
Serum RBP4 level was significantly higher and closely associated with blood pressure in prehypertensive Chinese. PMID: 28639612
Conclusion RBP4 may be used as a predictive factor of diabetic nephropathy patients complicated with silent cerebral infarction (SCI) and is positively correlated with cognitive dysfunction. RBP4/Lp-PLA2/Netrin-1 pathway activation may be one of the occurrence mechanisms in diabetic nephropathy complicated with SCI. PMID: 28704853
these data demonstrate a key role of STRA6 and RBP4 in the maintenance of colon cancer self-renewal and that this pathway is an important link through which consumption of HFD contributes to colon carcinogenesis. PMID: 28689994
Data suggest that, in subjects with chronic kidney disease, renal function is inversely related to serum RBP4 levels; as GFR decreases, the relationship between RBP4 and insulin resistance is attenuated. (GFR = glomerular filtration rate, a measure of kidney function) PMID: 28473187
Results identified RBP4 as a promising acute liver failure (ALF) biomarker among energy metabolism-related proteins. RBP4 values signaled liver injury at an early stage, as its decreasing level was observed before ALT elevation in the pig ALF model, and its significant decreasing level in ALF patients. PMID: 28336726
Elevated RBP4 is detectable early in pregnancy and has strong correlation with preeclampsia and premature birth. PMID: 28338737
RBP4-induced inflammation is largely mediated by TLR4. PMID: 28400700
RBP4 may be associated with higher cardiovascular risk in overweight/obese adolescent girls, but this association is mediated by abdominal obesity. PMID: 29120147
Bi-allelic mutations in RBP4 were identified (c.248+1G>A), consistent with a diagnosis of inherited vitamin A deficiency. PMID: 27892788
Childhood obesity may be associated with variations in RBP4 gene. The presence of selective SNPs in the RBP4 gene may account for metabolic complications. PMID: 26611784
Low levels of vitamin A, E and RBP4 at the time of renal cell carcinoma diagnosis are associated with a poorer prognosis after surgery. PMID: 28668878
RBP4 is some 6-fold lower when active TB patients have chronic energy deficiency (CED) than when BMI is >25 kg/m sq; however, free fatty acids were not associated with CED in active TB patients, which may be a type 2 error or represent an energy impasse where infection and the host's metabolic needs are in competition. PMID: 28625041
Data show that the tissue-specific expression pattern of human transgenic retinol binding protein 4 (hRBP4orf) was roughly the same as that of mouse Rbp4. PMID: 28134916
Elevated levels of RBP4 are associated with higher cardiovascular mortality among men with type 2 diabetes. PMID: 27609367
RBP4 and retinol levels were increased approximately twofold in patients with chronic kidney disease. PMID: 27277845
RBP4 level was associated with increased arterial stiffness in young subjects with family history of type 2 diabetes. PMID: 26868132
Retinol-binding protein 4 is able to function as biomarker to distinguish severe pre-eclampsia from normal pregnancy. More importantly, these results may shed light on the role of Retinol-binding protein 4 in the pathogenesis in pre-eclampsia. PMID: 27279411
High level of RBP4 is associated with obesity. PMID: 26794633
The positive association between circulating RBP4 and ApoB-containing lipoproteins in a steady metabolic state, as well as during a hypocaloric diet, appears to be attenuated in patients with very high serum triglycerides. PMID: 27086684
Urinary KNG1 and RBP4 clearly respond to AKI. Additionally, RBP4 could predict recovery by monitoring this protein levels over time after AKI, as RBP4 reflects patient's normalization earlier than sCr values do. PMID: 26792617
SNPsRBP4 was associated with age at onset in familial amyloid polyneuropathy. PMID: 26286643
Serum RBP4 is negatively related to estrogen in Chinese women with obesity. PMID: 26960804
Dietary vitamin A may reduce abdominal adiposity and promote visceral to subcutaneous body fat redistribution during adolescence in an RBP4-dependent manner. PMID: 26667887
The results of this meta-analysis support the hypothesis that RBP4 is a modest independent risk factor for gestational diabetes mellitus (i.e., nonobese patients with gestational diabetes mellitus might express RBP4 at abnormal levels).The association between RBP4 rs3758539 polymorphism and gestational diabetes mellitus risk was not confirmed. PMID: 26975349
RBP-4 levels are higher in patients with clinical hypothyroidism and exhibit a marked decrease after normalization of thyroid function in both hyper and hypothyroid patients. We suggest that RBP-4 may play a role in the metabolic disturbances which accompany thyroid dysfunction. PMID: 26575118
Fasting concentrations of RBP-4 were negatively correlated with BMI and waist-hip ratio, whereas lipocalin-2 levels were positively associated with BMI and waist-hip ratio. PMID: 26069091
male mice are susceptible to high fat diet-induced hyperglycaemia and display higher plasma RBP4 levels, possibly due to its over-expression in visceral adipose depots PMID: 26619134
RBP4 concentrations were significantly lower in hepatitis C subjects compared to controls. PMID: 26927700
Presence of gestational diabetes mellitus risk factors does not have an impact on early second trimester RBP-4 values in pregnant subjects. PMID: 25227411
This study describe the discovery and subsequent replications of RBP4 and its combination with circulating GFAP as plasmatic biomarkers for hyperacute stroke subtype differentiation. PMID: 26526443
Gc1s/Gc1s phenotype variant of DBP and the unbound fraction of plasma RBP4 may be considered as factors related with the incidence, and possibly the risk, of IR in CHC patients. PMID: 26962819
RBP correlated with IgG4 and IgA. RBP also correlated positively with age and with influenza virus-specific antibody neutralization titres. PMID: 26425827
Genetic variants of retinol-binding protein 4 in adolescents are associated with liver function and inflammatory markers but not with obesity and insulin resistance PMID: 26440092
Baseline serum RBP4 levels were independently associated with incident diabetes in Asian Indian men with impaired glucose tolerance. PMID: 25810022
Findings suggested that Asian women with gestational diabetes mellitus had increased circulating RBP4 levels in their second/third trimester. [Meta-Analysis] PMID: 25703255

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.