Recombinant Human Retinol-Binding Protein 4 (RBP4) Protein (hFc), Active
Beta LifeScience
SKU/CAT #: BLC-05849P
Recombinant Human Retinol-Binding Protein 4 (RBP4) Protein (hFc), Active
Beta LifeScience
SKU/CAT #: BLC-05849P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Retinol-Binding Protein 4 (RBP4) Protein (hFc), Active is produced by our Mammalian cell expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE and HPLC. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | 1. Measured by its binding ability in a functional ELISA. Immobilized RBP4 at 5 μg/ml can bind TTR , the EC 50 is 695.0-970.1 ng/ml. |
Uniprotkb | P02753 |
Target Symbol | RBP4 |
Synonyms | (Plasma retinol-binding protein)(PRBP)(RBP) |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | C-hFc |
Target Protein Sequence | ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL |
Expression Range | 19-201aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 50.0 kDa |
Research Area | Cancer |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Retinol-binding protein that mediates retinol transport in blood plasma. Delivers retinol from the liver stores to the peripheral tissues. Transfers the bound all-trans retinol to STRA6, that then facilitates retinol transport across the cell membrane. |
Subcellular Location | Secreted. |
Protein Families | Calycin superfamily, Lipocalin family |
Database References | |
Associated Diseases | Retinal dystrophy, iris coloboma, and comedogenic acne syndrome (RDCCAS); Microphthalmia, isolated, with coloboma, 10 (MCOPCB10) |
Tissue Specificity | Detected in blood plasma and in urine (at protein level). |
Gene Functions References
- Baseline RBP4 levels and MELD scores predicted 21-day ( /=25) mortality, respectively. In critically ill patients with underlying liver disease, with a link to eGFRs, INRs and TC levels, the baseline RBP4 may serve as a marker for short-term mortality. PMID: 28588245
- our study provides clinical evidence revealing that the serum concentrations of RBP4 were elevated in NAFLD patients in a Chinese population. These findings indicated that RBP4 might be a noninvasive molecular biomarker that detects the presence of NAFLD in middle-aged and elderly population. PMID: 28332619
- Vitreous levels of APOA1 and RBP4 in human rhegmatogenous retinal detachment associated with choroidal detachment reflects the severity of disease. PMID: 29618920
- The overexpression of RBP4 increased cell proliferation, whereas siRNA-mediated RBP4 knockdown significantly decreased HTR8/SVneo cell proliferation via activation of PI3K/AKT signaling. PMID: 30015949
- High RBP4 expression is associated with hypertriglyceridemia. PMID: 29747616
- We observed that knockdown of RBP4 can greatly suppress ovarian cancer cell migration and proliferation. PMID: 29642915
- This study showed that the Levels of circulating RBP4 was significantly higher in Chronic Kidney Disease than in control. PMID: 29678848
- Our results demonstrate that IR is associated with high circulating RBP4 and that suppressed RBP4 adipose tissue expression is accompanied by reduced GLUT4 expression in HD. Renal transplantation or HDF are effective in lowering serum RBP4 levels. PMID: 29333450
- Data suggest that serum levels of RBP4 and LGAL3BP are up-regulated after menopause when complicated by NAFLD (non-alcoholic fatty liver disease); RBP4 and LGAL3BP may serve as biomarkers of NAFLD in postmenopausal women. (RBP4 = retinol binding protein 4; LGAL3BP = galectin-3 binding protein) PMID: 29679552
- Elevated levels of RBP4 were not associated with an increased risk of ischemic stroke among women. PMID: 28888344
- Study showed that dietary weight loss-induced changes in angiotensin-converting enzyme activity, free fatty acids and RBP4 independently contribute to weight regain prediction. PMID: 29122953
- RBP4 is involved in all-trans retinoic acid-induced cleft palate. PMID: 28849085
- the 1.5A resolution structures of human holo-RBP4 and of the protein saturated with palmitic and lauric acid and discuss the interaction of the fatty acids and retinol with the protein, are reported. PMID: 29414511
- Circulating RBP4 levels may not be associated with nonalcoholic fatty liver disease. PMID: 28931435
- Plasma PEDF and RBP4 identified insulin resistance in subjects with no prior diagnosis of diabetes. PMID: 28648555
- Serum RBP4 level was significantly higher and closely associated with blood pressure in prehypertensive Chinese. PMID: 28639612
- Conclusion RBP4 may be used as a predictive factor of diabetic nephropathy patients complicated with silent cerebral infarction (SCI) and is positively correlated with cognitive dysfunction. RBP4/Lp-PLA2/Netrin-1 pathway activation may be one of the occurrence mechanisms in diabetic nephropathy complicated with SCI. PMID: 28704853
- these data demonstrate a key role of STRA6 and RBP4 in the maintenance of colon cancer self-renewal and that this pathway is an important link through which consumption of HFD contributes to colon carcinogenesis. PMID: 28689994
- Data suggest that, in subjects with chronic kidney disease, renal function is inversely related to serum RBP4 levels; as GFR decreases, the relationship between RBP4 and insulin resistance is attenuated. (GFR = glomerular filtration rate, a measure of kidney function) PMID: 28473187
- Results identified RBP4 as a promising acute liver failure (ALF) biomarker among energy metabolism-related proteins. RBP4 values signaled liver injury at an early stage, as its decreasing level was observed before ALT elevation in the pig ALF model, and its significant decreasing level in ALF patients. PMID: 28336726
- Elevated RBP4 is detectable early in pregnancy and has strong correlation with preeclampsia and premature birth. PMID: 28338737
- RBP4-induced inflammation is largely mediated by TLR4. PMID: 28400700
- RBP4 may be associated with higher cardiovascular risk in overweight/obese adolescent girls, but this association is mediated by abdominal obesity. PMID: 29120147
- Bi-allelic mutations in RBP4 were identified (c.248+1G>A), consistent with a diagnosis of inherited vitamin A deficiency. PMID: 27892788
- Childhood obesity may be associated with variations in RBP4 gene. The presence of selective SNPs in the RBP4 gene may account for metabolic complications. PMID: 26611784
- Low levels of vitamin A, E and RBP4 at the time of renal cell carcinoma diagnosis are associated with a poorer prognosis after surgery. PMID: 28668878
- RBP4 is some 6-fold lower when active TB patients have chronic energy deficiency (CED) than when BMI is >25 kg/m sq; however, free fatty acids were not associated with CED in active TB patients, which may be a type 2 error or represent an energy impasse where infection and the host's metabolic needs are in competition. PMID: 28625041
- Data show that the tissue-specific expression pattern of human transgenic retinol binding protein 4 (hRBP4orf) was roughly the same as that of mouse Rbp4. PMID: 28134916
- Elevated levels of RBP4 are associated with higher cardiovascular mortality among men with type 2 diabetes. PMID: 27609367
- RBP4 and retinol levels were increased approximately twofold in patients with chronic kidney disease. PMID: 27277845
- RBP4 level was associated with increased arterial stiffness in young subjects with family history of type 2 diabetes. PMID: 26868132
- Retinol-binding protein 4 is able to function as biomarker to distinguish severe pre-eclampsia from normal pregnancy. More importantly, these results may shed light on the role of Retinol-binding protein 4 in the pathogenesis in pre-eclampsia. PMID: 27279411
- High level of RBP4 is associated with obesity. PMID: 26794633
- The positive association between circulating RBP4 and ApoB-containing lipoproteins in a steady metabolic state, as well as during a hypocaloric diet, appears to be attenuated in patients with very high serum triglycerides. PMID: 27086684
- Urinary KNG1 and RBP4 clearly respond to AKI. Additionally, RBP4 could predict recovery by monitoring this protein levels over time after AKI, as RBP4 reflects patient's normalization earlier than sCr values do. PMID: 26792617
- SNPsRBP4 was associated with age at onset in familial amyloid polyneuropathy. PMID: 26286643
- Serum RBP4 is negatively related to estrogen in Chinese women with obesity. PMID: 26960804
- Dietary vitamin A may reduce abdominal adiposity and promote visceral to subcutaneous body fat redistribution during adolescence in an RBP4-dependent manner. PMID: 26667887
- The results of this meta-analysis support the hypothesis that RBP4 is a modest independent risk factor for gestational diabetes mellitus (i.e., nonobese patients with gestational diabetes mellitus might express RBP4 at abnormal levels).The association between RBP4 rs3758539 polymorphism and gestational diabetes mellitus risk was not confirmed. PMID: 26975349
- RBP-4 levels are higher in patients with clinical hypothyroidism and exhibit a marked decrease after normalization of thyroid function in both hyper and hypothyroid patients. We suggest that RBP-4 may play a role in the metabolic disturbances which accompany thyroid dysfunction. PMID: 26575118
- Fasting concentrations of RBP-4 were negatively correlated with BMI and waist-hip ratio, whereas lipocalin-2 levels were positively associated with BMI and waist-hip ratio. PMID: 26069091
- male mice are susceptible to high fat diet-induced hyperglycaemia and display higher plasma RBP4 levels, possibly due to its over-expression in visceral adipose depots PMID: 26619134
- RBP4 concentrations were significantly lower in hepatitis C subjects compared to controls. PMID: 26927700
- Presence of gestational diabetes mellitus risk factors does not have an impact on early second trimester RBP-4 values in pregnant subjects. PMID: 25227411
- This study describe the discovery and subsequent replications of RBP4 and its combination with circulating GFAP as plasmatic biomarkers for hyperacute stroke subtype differentiation. PMID: 26526443
- Gc1s/Gc1s phenotype variant of DBP and the unbound fraction of plasma RBP4 may be considered as factors related with the incidence, and possibly the risk, of IR in CHC patients. PMID: 26962819
- RBP correlated with IgG4 and IgA. RBP also correlated positively with age and with influenza virus-specific antibody neutralization titres. PMID: 26425827
- Genetic variants of retinol-binding protein 4 in adolescents are associated with liver function and inflammatory markers but not with obesity and insulin resistance PMID: 26440092
- Baseline serum RBP4 levels were independently associated with incident diabetes in Asian Indian men with impaired glucose tolerance. PMID: 25810022
- Findings suggested that Asian women with gestational diabetes mellitus had increased circulating RBP4 levels in their second/third trimester. [Meta-Analysis] PMID: 25703255