Recombinant Human SDF1 Protein
Beta LifeScience
SKU/CAT #: BLA-2230P
Recombinant Human SDF1 Protein
Beta LifeScience
SKU/CAT #: BLA-2230P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P48061-2 |
Synonym | 12-O-tetradecanoylphorbol 13-acetate repressed protein 1 AI174028 C-X-C motif chemokine 12 Chemokine (C-X-C motif) ligand 12 Chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) Chemokine CXC motif ligand 12 cxcl12 hIRH hSDF-1 Intercrine reduced in hepatomas IRH OTTHUMP00000019491 PBSF Pre-B cell growth-stimulating factor SCYB12 SDF 1 SDF-1 SDF-1-alpha(3-67) SDF-1a SDF-1b SDF1_HUMAN SDF1A SDF1B Stromal cell-derived factor 1 Stromal cell-derived factor 1 delta Stromal cell-derived factor 1 gamma Stromal cell-derived factor 1a Stromal cell-derived factor-1 alpha Thymic lymphoma cell-stimulating factor Tlsf TLSF-a TLSF-b Tlsfa Tlsfb TPAR1 |
Description | Recombinant Human SDF1 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKIL NTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |