Recombinant Human Serum Amyloid P/SAP Protein
Beta LifeScience
SKU/CAT #: BLA-1089P
Recombinant Human Serum Amyloid P/SAP Protein
Beta LifeScience
SKU/CAT #: BLA-1089P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P02743 |
Synonym | 9.5S alpha 1 glycoprotein 9.5S alpha-1-glycoprotein Amyloid P component serum APCS MGC88159 Pentaxin related Pentraxin 2 PTX 2 PTX2 SAMP_HUMAN SAP Serum Amyloid P Serum amyloid P component Serum amyloid P-component(1-203) |
Description | Recombinant Human Serum Amyloid P/SAP Protein was expressed in Mammalian. It is a Full length protein |
Source | Mammalian |
AA Sequence | HTDLSGKVFVFPRESVTDHVNLITPLEKPLQNFTLCFRAYSDLSRAYSLF SYNTQGRDNELLVYKERVGEYSLYIGRHKVTSKVIEKFPAPVHICVSWES SSGIAEFWINGTPLVKKGLRQGYFVEAQPKIVLGQEQDSYGGKFDRSQSF VGEIGDLYMWDSVLPPENILSAYQGTPLPA NILDWQALNYEIRGYVIIKPLVWVDHHHHHH |
Molecular Weight | 23 kDa |
Purity | >95% SDS-PAGE.Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycle. |
Target Details
Target Function | Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. May also function as a calcium-dependent lectin. |
Subcellular Location | Secreted. |
Protein Families | Pentraxin family |
Database References | |
Associated Diseases | SAP is a precursor of amyloid component P which is found in basement membrane and associated with amyloid deposits. |
Tissue Specificity | Found in serum and urine. |
Gene Functions References
- The findings suggest that the F57I mutation affects the aggregation process of lysozyme resulting in the formation of cytotoxic species and that SAP is able to prevent cell death in the F57I flies by preventing accumulation of toxic F57I structures. PMID: 27428539
- Data suggest that SAP (serum amyloid P-component) interacts with at least 33 proteins/ligands in plasma containing physiological calcium levels; these ligands can be categorized to include apolipoproteins, complement system proteins, coagulation proteins, and components that regulate proteolysis. PMID: 28098450
- Data suggest that serum haptoglobin, fetuin-A, platelet factor-4, hs-CRP (high sensitive-C-reactive protein), SAP (serum amyloid P), AGP (alpha1-acid glycoprotein) levels of adolescents with metabolic syndrome are significantly higher than those of controls subjects. PMID: 27754964
- SNPs in APCS were associated with late age at onset in familial amyloid polyneuropathy. PMID: 26286643
- Data suggest that serum amyloid P (SAP) activates CD209 DC-SIGN to regulate the innate immune system differently from C-reactive protein (CRP), and that DC-SIGN is a target for antifibrotics. PMID: 26106150
- Here, it is reported that X-ray analysis of the SAP complex with CPHPC and cadmium ions provides higher resolution detail of the interaction than is observed with calcium ions. PMID: 25084341
- Compared to wildtype C57BL/6 mice, we find that in Apcs-/- "SAP knock-out" mice, bleomycin induces a more persistent inflammatory response and increased fibrosis. PMID: 24695531
- The effects of SAP and Xiapex (Collagenase Clostridium histolyticum) on fibrocytes derived from Dupuytren's disease, was evaluated. PMID: 24933153
- plasma protein serum amyloid P binds to FcgammaRI on monocytes to inhibit fibrocyte differentiation, and binds to FcgammaRIIa on neutrophils to reduce neutrophil adhesion. PMID: 25024390
- In the late phase post-myocardial infarct there is a coordinated decrease in immune response-inflammation proteins, except for SAP which showed an increase related to the specific activation of the classical complement pathway. PMID: 23992930
- 9 different proteins (haptoglobin, transthyretin, apolipoprotein A-1, serum amyloid P component, apolipoprotein E, complement factor H, fibrinogen gamma, thrombin, complement C3) were identified as a potential diagnostic pattern of Parkinson's disease. PMID: 23385359
- Human SAP binds phosphoethanolamine, while rabbits seem to have low levels of SAP that bind to a lesser extent. PMID: 23600950
- These results indicate that SAP functions as a host defense factor, similar to other peptidoglycan recognition proteins and nucleotide-binding oligomerization domain-like receptors. PMID: 23966633
- SAP may act as an effective receptor mimic to limit influenza A virus infection of airway epithelial cells. PMID: 23544079
- Persons who develop non-affective psychoses have lower levels of certain acute phase proteins, including SAP, at the time of birth. PMID: 23423137
- [review] On the basis of structure, serum amyloid P component is a prototype of the short pentraxin family. PMID: 23527487
- SAP has a new role in reducing the toxicity of early amyloidogenic aggregates in transthyretin amiloidosis. PMID: 23390551
- observations suggest that serum amyloid P, at least in part, uses FcgammaRI and FcRgamma to inhibit fibrocyte differentiation PMID: 22493081
- Low levels of serum amyloid P mark the brains of individuals who escape dementia despite the presence of beta amyloid plaques and tangles in Alzheimer's disease neuropathology. PMID: 22205573
- Studies indicate that pharmaceutical grade serum amyloid P component and C-reactive protein were isolated and purified. PMID: 22867744
- The START domain in GPBP is important for this interaction. SAP and GPBP form complexes in blood and partly colocalize in amyloid plaques from Alzheimer disease patients. PMID: 22396542
- Serum amyloid P level increased by approximately 5-fold in Parkinson's disease samples;a potential feasibility of plasma amyloid P as a marker to approach Parkinson's disease PMID: 21223953
- Under physiological conditions, phosphoethanolamine is bound with higher affinity by human SAP than by human CRP. PMID: 21360619
- TGF-beta driven lung fibrosis is macrophage dependent and blocked by Serum amyloid P. PMID: 21044893
- these data suggest that local production of serum amyloid P and c-reactive protein in the alzheimer disease brain does not substantially contribute to the CSF levels. PMID: 20930309
- Human SAP inhibits DNA-mediated innate immune activation in vitro and may limit innate and adaptive immune responses after DNA vaccination of transgenic mice. PMID: 21278351
- serum SAP levels may be an easy detected predictor for the healing of burn wounds PMID: 20932823
- Interaction between MBL and PTX3 led to communication between the lectin and classical complement pathways via recruitment of C1q, whereas SAP-enhanced complement activation occurs via a hitherto unknown mechanism PMID: 21106539
- SAP has an effect on macrophages in fibrotic lung disease PMID: 20300636
- Functional analysis demonstrated that SAP associated with HDL promotes SR-BI-dependent cholesterol efflux and lipid-free SAP enhances ABCA1-dependent cholesterol efflux PMID: 20189569
- A possible role of SAP in either host resistance or viral virulence was investigated during influenza infection in vivo. Influenza virus infection is not affected by serum amyloid P component.Human SAP binds much more avidly than mouse SAP to the virus. PMID: 11984001
- Targeted pharmacological depletion of serum amyloid P component for treatment of human amyloidosis. PMID: 12015594
- serum amyloid P component does not circulate in complex with C4-binding protein, fibronectin or any other major protein ligand PMID: 12100475
- structures of crystalline complexes of human serum amyloid P component with its carbohydrate ligand, the cyclic pyruvate acetal of galactose PMID: 12126626
- Serum amyloid p component binds to late apoptotic cells and is involved in the phagocytosis of these cells by human monocyte-derived macrophages. PMID: 12528126
- Serum amyloid P component binding to Shiga toxin 2 requires both a subunit and B pentamer. PMID: 14500533
- Purified SAP inhibits fibrocyte differentiation at levels similar to those found in plasma, while depleting SAP reduces the ability of plasma to inhibit fibrocyte differentiation. PMID: 14607961
- This protein, a non-fibrillar component, causes soluble fibrils to condense into localized fibrillar aggregates with a greatly enhanced local density of fibril entanglements. PMID: 15031287
- Genetic variation in APCS is associated with amyloid polyneuropathy PMID: 15649951
- Amyloid-associated SAP significantly increases fibrillar prion protein-related peptide-induced release of interleukin-6 and TNF-alpha from human microglia. PMID: 15837583
- Review discusses clinical significance of different levels of SAP, its role in induction or protection from autoimmunity, and the presence of specific SAP autoantibodies in different autoimmune diseases. PMID: 16380821
- the shared specificity as well as their shared capability to activate complement, suggest that IgM and the pentraxins CRP and SAP exert similar functions in the removal of apoptotic cells PMID: 16643876
- Monocytes bound biotinylated serum amyloid P component with avidity in a dose-dependent and saturable manner; speculated that binding of SAP by monocytes could be of physiological relevance at extravascular sites by influencing complement regulation PMID: 16784490
- Serum amyloid P (SAP) and C-reactive protein (CRP) may represent different facets of inflammation. The association of SAP with cardiovascular disease in these older adults further supports the role of innate immunity in atherosclerosis. PMID: 17138933
- No reduced circulating concentrations of serum amyloid P component (SAP) in patients with systemic sclerosis, nor any evidence of an association between SAP levels and the extent or severity of fibrosis were observed. PMID: 17530641
- SAP may modulate the inflammatory response to amyloid fibrils in atherosclerosis PMID: 17630380
- SAP was quantitated using PVDF affinity probes and MALDI-MS. PMID: 17676666
- The complex structure between human SAP and FcgammaRIIa reveals a diagonally bound receptor on each SAP pentamer with both D1 and D2 domains of the receptor contacting the ridge helices from two SAP subunits. PMID: 19011614
- Our data suggest that measurement of cerebrospinal fluid SAP levels can aid in the identification of incipient Alzheimer's disease among mild cognitive impairment patients PMID: 19052452
- Serum amyloid P binds to cells in the early stage of apoptosis, presumably via phosphatidylethanolamine exposed in flip-flopped membranes, suggesting a role for serum amyloid P in the clearance of these cells in vivo. PMID: 11441067