Recombinant Human SLAM / CD150 Protein
Beta LifeScience
SKU/CAT #: BLA-8271P
Recombinant Human SLAM / CD150 Protein
Beta LifeScience
SKU/CAT #: BLA-8271P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q13291 |
Synonym | 4933415F16 AA177906 CD 150 CD150 CD150 antigen CDw150 Estm51 Ipo 3 IPO-3 Ipo3 MGC151472 MGC151476 OTTHUMP00000025670 OTTHUMP00000060252 RGD1560634 Signaling lymphocytic activation molecule Signaling lymphocytic activation molecule family member 1 Signaling lymphocytic activation molecule family member 1, isoform CRA_a Signaling lymphocytic activation molecule family member 1, isoform CRA_b Signaling lymphocytic activation molecule precursor Slaf1 SLAF1_HUMAN SLAM family, member 1 Slamf 1 SLAMF1 SLAMF1 protein |
Description | Recombinant Human SLAM / CD150 Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSL ENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLM TLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGD HVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQ TFSPWPGCRTDPSETKPVDHHHHHH |
Molecular Weight | 25 kDa including tags |
Purity | >95% SDS-PAGE.Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -80°C. |