Recombinant Human Sodium-Dependent Phosphate Transport Protein 2B (SLC34A2) Protein (His-B2M)

Name: Recombinant Human Sodium-Dependent Phosphate Transport Protein 2B (SLC34A2) Protein (His-B2M)
Brand: Beta LifeScience
SKU: BLC-03669P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: Fc receptors, Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Sodium-Dependent Phosphate Transport Protein 2B (SLC34A2) Protein (His-B2M) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	O95436
Target Symbol	SLC34A2
Synonyms	SLC34A2; Sodium-dependent phosphate transport protein 2B; Sodium-phosphate transport protein 2B; Na(+)-dependent phosphate cotransporter 2B; NaPi3b; Sodium/phosphate cotransporter 2B; Na(+)/Pi cotransporter 2B; NaPi-2b; Solute carrier family 34 member 2
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-B2M
Target Protein Sequence	LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA
Expression Range	574-689aa
Protein Length	Partial
Mol. Weight	27.1 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May be involved in actively transporting phosphate into cells via Na(+) cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli.
Subcellular Location	Membrane; Multi-pass membrane protein.
Protein Families	SLC34A transporter family
Database References	HGNC: 11020 OMIM: 265100 KEGG: hsa:10568 STRING: 9606.ENSP00000371483 UniGene: Hs.479372
Associated Diseases	Pulmonary alveolar microlithiasis (PALM)
Tissue Specificity	Highly expressed in lung. Also detected in pancreas, kidney, small intestine, ovary, testis, prostate and mammary gland. In lung, it is found in alveolar type II cells but not in bronchiolar epithelium.

Gene Functions References

The upstream breakpoint lies in the same region as the breakpoint of a fused gene SLC34A2-ROS1, which encodes a constitutive kinase in the lung cancer cell line HCC78 and nonsmall-cell lung cancer (NSCLC), suggesting that the deletion in this family is a hot spot for recombination, not only in cancer samples with somatic mutation, but also in PAM patients with germline genetic defects of SLC34A2. PMID: 30262706
SLC34A2 plays a crucial promoting role in colorectal cancer development. PMID: 29653487
Studied expression of solute carrier family 34 member 2 (SLC34A2/NaPi2b) in epithelial ovarian cancer using monoclonal antibody MX35 and immunohistochemistry. Different staining intensities were observed in different grades of epithelial ovarian cancer. PMID: 28464843
Low SLC34A2 expression is associated with non-small cell lung cancer. PMID: 26910912
SLC34A2 has an important role in promoting proliferation and tumorigenicity of BC. PMID: 28151475
SLC34A2 was down-regulated in osteosarcoma patients.SLC34A2 interacted with PTEN, and decreased the phosphorylation of PI3K and AKT, which inactivated the PI3K/AKT signaling pathway. PMID: 28777670
High expression of SLC34A2 was identified in about 2/3 patients and correlated with significantly better patient's overall survival. Epidermal growth factor receptor mutations were detected in about 53% of patients with no statistically significant difference to patient's overall survival. Anaplastic lymphoma kinase rearrangement was found in 8 out of 175 patients, harboring this abnormality leads to shorter overall survi PMID: 28720066
we elucidated that miR-939 exerted its function mainly through inhibiting SLC34A2/Raf/MEK/ERK pathway, which is activated in GC. Multivariate analysis identified miR-939, SLC34A2, and their combination as independent indicators for poor prognosis and tumor recurrence in GC patients. PMID: 28114937
a novel role of SLC34A2 inbreast cancer stem cells (BCSCs) state regulation and establishes a rationale for targeting the SLC34A2/PI3K/AKT/SOX2 signaling pathway for breast cancer therapy. PMID: 28381172
Knockdown of SLC34A2 inhibits proliferation. PMID: 28281971
Our work sheds new light on the nature of the state of lung cancer stem cell-like cells and the role of SLC34A2 in the tumorigenicity of these cells PMID: 26846105
our data indicated that SLC34A2 could exert significantly suppressive effects on tumorigenesis and progression of NSCLC. SLC34A2 might provide new insights for further understanding the early pathogenesis of human non-small cell lung cancer PMID: 26156586
SLC34A2 might be associated with the initiation and progression of lung adenocarcinoma PMID: 25017204
Data indicate that humanized monoclonal antibody Rebmab200 and murine monoclonal antibody MX35 monoclonal antibodies had similar specificity for sodium phosphate transporter NaPi2b. PMID: 23936189
investigation revealed that the c.910A > T mutation in the SCL34A2 gene was responsible for pulmonary alveolar microlithiasis (PAM) patients in China PMID: 23164546
identified 2 cases of pulmonary alveolar microlithiasis(PAM) with new mutations of SLC34A2 gene; identified the NaPi-IIb in a aortic valve; hypothesize that mutations in SLC34A2 may play a role in development of aortic valve calcification and arteriosclerosis PMID: 22336687
a comprehensive analysis indicates that SCL34A2 is the only gene of the several phosphate transporters genes whose expression differentiates normal from carcinoma samples, suggesting it might exert a major role in ovarian carcinomas. PMID: 22553815
The performed study revealed that SLC34A2 gene exhibited the most distinct change in expression and may become a molecular marker of papillary thyroid cancer PMID: 17091453
study provides the data on the pattern of NaPi2b expression and cellular localization in breast, lung and ovarian cancers PMID: 21956469
Upregulation of SLC34A2 gene expression in well-differentiated tumors may reflect cell differentiation processes during ovarian cancerogenesis and could serve as potential marker for ovarian cancer diagnosis and prognosis. PMID: 21716206
There was a significantly increased gene expression of SLC34A2 (normal tissues: 6.71+/-0.77; tumour tissues: 10.29+/-0.80) among breast cancer tissues compared with normal tissues. PMID: 21036732
In human lung alveolar epithelial cells, the content of calcium and phosphate in cell supernatant decreased with increased amount of SLC34A2 mRNA. PMID: 19134407
study describes mutations in SLC34A 2 gene in an inbred Turkish family with three siblings diagnosed with pulmonary alveolar microlithiasis(PAM); findings suggest that impaired activity of the SLC34A2 gene may be responsible for familial PAM PMID: 20046000
A novel mutation in exon 8 of the SLC34A2 gene were associated with pulmonary alveolar microlithiasis in Chinese pedigree. PMID: 20017296
The current study was performed to characterize the minimal promoter region and transcriptional factor(s) necessary to activate gene expression of NaPi-IIb in human intestinal cells. PMID: 15458926
Study identified a pulmonary alveolar microlithiasis locus by homozygosity mapping to 4p15, then identified, by a candidate-gene approach, the gene responsible for the disease as SLC34A2, which is involved in phosphate homeostasis in several organs. PMID: 16960801
Mutations in the SLC34A2 gene that abolish normal gene function cause pulmonary alveolar microlithiasis. PMID: 17095743
The monoclonal antibodies were shown to recognize specifically transiently overexpressed and endogenous NaPi2b in commonly used immunoassays. PMID: 18724815
SLC34A2 is associated with sodium-lithium countertransport activity and blood pressure PMID: 19119262
The gene responsible for PAM, SLC34A2, has been identified. It encodes a type IIb sodium-dependent phosphate transporter, the function of which provides an insight into the pathogenesis of this disease. PMID: 19617834

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.