Recombinant Human sTRAIL Receptor 2 Protein

Name: Recombinant Human sTRAIL Receptor 2 Protein
Brand: Beta LifeScience
SKU: BLA-8577P
Availability: InStock

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Cytokines and growth factors, Recombinant proteins, Tumor necrosis factors and receptors (tnfs)

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	O14763-2
Synonym	Apoptosis inducing protein TRICK2A 2B Apoptosis inducing protein TRICK2A/2B Apoptosis inducing receptor TRAIL R2 CD262 CD262 antigen Cytotoxic TRAIL receptor 2 Death domain containing receptor for TRAIL Apo 2L Death receptor 5 DR5 Fas like protein Killer Killer DR5 KILLER/DR5 p53 regulated DNA damage inducible cell death receptor killer p53 regulated DNA damage inducible cell death receptor(killer) TNF receptor superfamily member 10b TNF related apoptosis inducing ligand receptor 2 TNF-related apoptosis-inducing ligand receptor 2 TNFRSF10B TR10B_HUMAN Trail R2 TRAIL receptor 2 TRAIL-R2 TRAILR2 TRICK2 TRICK2A TRICK2B TRICKB Tumor necrosis factor receptor like protein ZTNFR9 Tumor necrosis factor receptor superfamily member 10B Tumor necrosis factor receptor superfamily, member 10b ZTNFR9
Description	Recombinant Human sTRAIL Receptor 2 Protein was expressed in HEK293. It is a Protein fragment
Source	HEK293
AA Sequence	ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYST HWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRK CRTGCPRGMVKVGDCTPWSD IECVHKEVDHHHHH
Molecular Weight	15 kDa including tags
Purity	>95% SDS-PAGE.Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. The lyo

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.