Recombinant Human Teratocarcinoma-Derived Growth Factor 1 (TDGF1) Protein (His)

Name: Recombinant Human Teratocarcinoma-Derived Growth Factor 1 (TDGF1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-08326P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Cytokines, Cytokines and growth factors, Growth factors and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Teratocarcinoma-Derived Growth Factor 1 (TDGF1) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P13385
Target Symbol	TDGF1
Synonyms	CR; CRGF; Cripto 1; Cripto 1 growth factor; cripto; Cripto-1 growth factor; Cripto1 growth factor; Epidermal growth factor like cripto protein CR1; Epidermal growth factor-like cripto protein CR1; TDGF 1; TDGF1; TDGF1_HUMAN; Teratocarcinoma derived growth factor 1; Teratocarcinoma-derived growth factor 1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	GHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD
Expression Range	32-150aa
Protein Length	Partial
Mol. Weight	17.5kDa
Research Area	Developmental Biology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	GPI-anchored cell membrane protein involved in Nodal signaling. Cell-associated TDGF1 acts as a Nodal coreceptor in cis. Shedding of TDGF1 by TMEM8A modulates Nodal signaling by allowing soluble TDGF1 to act as a Nodal coreceptor on other cells. Could play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm.
Subcellular Location	Cell membrane; Lipid-anchor, GPI-anchor. Secreted.
Protein Families	EGF-CFC (Cripto-1/FRL1/Cryptic) family
Database References	HGNC: 11701 OMIM: 187395 KEGG: hsa:6997 STRING: 9606.ENSP00000296145 UniGene: Hs.385870
Tissue Specificity	Preferentially expressed in gastric and colorectal carcinomas than in their normal counterparts. Expressed in breast and lung.

Gene Functions References

Cripto-1 expression is increased by OCT4 overexpression, but decreased by shRNA-mediated OCT4 knockdown. OCT4 overexpression significantly activates Cripto-1 transcriptional activity. A 5'-upstream minimal promoter sequence in the gene-encoding Cripto-1 is significantly activated by OCT4 overexpression. PMID: 29223130
Targeting the Cripto-1/TAK-1/NF-kappaB/Survivin pathway may be an effective approach to combat apoptosis resistance in cancer. PMID: 29807222
Knockdown of Cripto-1 inhibits the proliferation, migration, invasion, and angiogenesis in prostate carcinoma cells. PMID: 29358554
Results identified elevated CR-1 expression in esophageal squamous cell carcinoma (ESCC) specimens which correlated to poor prognosis of the patients. CR-1 high cells isolated from ESCC cells possess cancer stem-like cells (ECSLC) properties. PMID: 28431580
These results highlight a functional role for CRIPTO and GRP78 in prostate cancer metastasis and suggest that targeting CRIPTO/GRP78 signaling may have significant therapeutic potential. PMID: 28394345
PGAP6 plays a critical role in Nodal signaling modulation through CRIPTO shedding. PMID: 27881714
Upregulation of cripto-1 is associated with prostate cancer. PMID: 28098905
the miR-15b expression is negatively associated with the cripto-1 expression in glioma cells. miR-15b may subsequently impair growth and invasion of glioma cells through targeted regulation of cripto-1. PMID: 27082313
These findings suggest that CRIPTO expression may be a useful serological marker for diagnostic and/or prognostic purposes during germ cell cancer management. PMID: 26654129
serum CR-1 is a useful diagnostic and prognostic marker for nonsmall cell lung cancer patients. PMID: 26109366
Cripto-1 overexpression contributes to aggressiveness and poor prognosis of hepatocellular carcinoma PMID: 26375669
The main signaling pathways mediating Cripto-1 effects include Nodal-dependent (Smad2/3) and Nodal-independent (Src/p44/42/Akt) signaling transduction pathways PMID: 26327334
Cripto-1 is a novel and dynamically regulated effector of stem cell functions in colorectal cancer. PMID: 26343543
these findings suggest a novel molecular network, involving CRIPTO, AKT, and FGFR signaling, in favor of the emergence of mesenchymal-like cancer cells during the development of aggressive prostate tumors. PMID: 25596738
Report lower gene expression of Cripto in endometriosis but difference not maintained at protein level. PMID: 25228630
Treatment of U-87 MG cells with CR-1 leads to higher expression of drug efflux protein MDR-1 in the CR-1 positive subpopulation, indicating correlated induction of these two proteins. PMID: 25658584
These findings clearly suggest that the downregulation of miR-15a-16 with Cripto amplification may be involved in the development of nonsmall cell lung cancer. PMID: 24500260
Snail represses Cripto-1 gene by direct transcriptional interaction PMID: 25889638
CR-1 expression in glioblastoma multiforme(GBM)tissue and blood; CR-1 plasma levels from GBM patients were elevated compared with normal; CR-1 concentrations higher than normal correlated with shorter overall survival; identified CR-1 in different areas of GBM tissue including perivascular tumor cells and endothelial cells PMID: 24521322
the functional analysis of the main associated locus identified a causal variant in the 5'UTR of CRIPTO gene which is able to strongly modulate CRIPTO expression through an AP-1-mediate transcriptional regulation. PMID: 25629528
Our findings suggest that high Cripto-1 expression might be involved in the development of bladder cancer and a potentially effective prognostic marker in bladder cancer patients PMID: 25326807
Over expression of Cripto-1 was correlated with the occurrence, development, metastasis and malignant degree of lung adenocarcinoma. PMID: 25796148
these findings identify the CRIPTO/GRP78 pathway as a developmentally conserved regulator of fetal and adult mammary stem cell behavior ex vivo, with implications for the stem-like cells found in many cancers. PMID: 24749068
This study demonstrated CR-1 expression in the placental bed, its increased expression in creta placentas, and EVT cells as the main CR-1-producing cell type. PMID: 25165718
Data suggest that the high expression of Cripto-1 (CR-1) may play an important role in the progression of non-small cell lung cancer (NSCLC), and CR-1 expression may offer a valuable marker for predicting the outcome of patients with NSCLC. PMID: 24870591
Tumors from NSCLC patients with EGFR-activating mutations that were intrinsically resistant to EGFR-TKIs expressed higher levels of CRIPTO1 compared with tumors from patients that were sensitive to EGFR-TKIs. PMID: 24911146
Cripto is overexpressed in colonic neoplasms and is related to cancer cell migration/invasion. PMID: 24379580
The significance of cell surface CR-1 expression in human melanoma cells, was examined. PMID: 23574716
Cross-talk between Cripto-1 and the Wnt/beta-catenin signaling pathway might play a role in mammary transformation leading to a more aggressive behavior of mammary cancer cells. PMID: 23022962
Offer some insight into the transcriptional regulation of CR-1 gene expression and its critical role in the pathogenesis of human cancer. PMID: 23129342
human testicular tumors showed upregulation of NODAL and CRIPTO that was proportional to invasiveness and to the number of malignant cells. PMID: 23034635
Cripto/GRP78 modulates the TGF-beta pathway in development and oncogenesis [review] PMID: 22306319
Cripto-1 may play a role during developmental EMT, and it may also be involved in the reprogramming of differentiated tumor cells into cancer stem cells through the induction of an EMT program. PMID: 22542493
Cripto-1 plays a role in the malignant transformation of oral mucosa and is involved in the tumorigenesis and progression of oral squamous cell carcinoma by promoting the growth and migration of malignant cells. PMID: 21824804
High CRIPTO-1 is associated with cutaneous melanoma. PMID: 21863025
Disturbed expression of endometrial activin A, cripto , and follistatin suggests a dysfunction of the activin pathway in endometriosis/endometrioma. PMID: 21496809
work firstly provides human genetic evidence of TDGF1 involved in the pathogenesis of ventricular septal defects PMID: 19853938
expression of CR-1 may alter the physiochemical properties of the plasma membrane resulting in an enhancement of intercellular transfer of cellular signaling components which may account for the paracrine activity of CR-1. PMID: 21055389
Results demonstrate that CR-1 expression is enriched in an undifferentiated, tumorigenic subpopulation and is regulated by key regulators of pluripotent stem cells. PMID: 20549704
molecular model of activin receptor-like kinase 4/Cripto/Nodal complex built by homology modeling as well as docking tests aimed at identifying potential binding epitopes PMID: 20629020
TDGF1 has a role in metachronous metastasis of colorectal cancer PMID: 20126975
TDGF-1, which is significantly upregulated in APA and mediates aldosterone hypersecretion and deregulated growth in adrenocortical cells in vitro, may represent a key player in the development and pathophysiology of primary aldosteronism. PMID: 20385969
Nodal and Cripto immunoreactivity increased dramatically in the transition from histologic Grade 1 to histologic Grades 2 and 3 endometrial carcinomas. PMID: 19874624
Cripto has dual roles as a coreceptor as well as a coligand for Nodal and that this signaling interaction with Nodal is regulated by an unusual form of glycosylation. PMID: 12052855
A loss-of-function mutation in the CFC domain of TDGF1 is associated with human forebrain defects. PMID: 12073012
complexation with activin and type II activin receptors and role in blocking activin signaling PMID: 12682303
CRIPTO signaling promotes cardiomyogenesis and redirects the neural fate of embryonic stem cells. PMID: 14581455
Results suggest that cripto-1 overexpression might be associated with the progression towards a more aggressive phenotype in breast carcinoma, through the activation of both Akt and Smad-2 signalling pathways. PMID: 14584041
The regulation of Netrin-1 expression is important in regulating Cripto-1-dependent invasion and migration of mammary epithelial cells. PMID: 16176936
The plasma CR-1 might represent a novel biomarker for the detection of breast and colon carcinomas. A statistically significant increase in the levels of plasma CR-1 was found in patients with colon carcinoma and in patients with breast carcinoma. PMID: 16951234

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.