Recombinant Human TGF alpha Protein
Beta LifeScience
SKU/CAT #: BLA-1952P
Recombinant Human TGF alpha Protein
Beta LifeScience
SKU/CAT #: BLA-1952P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P01135 |
Synonym | EGF like TGF EGF-like TGF ETGF TFGA TGF A TGF type 1 TGF-alpha Tgfa TGFA_HUMAN Transforming growth factor alpha Transforming growth factor alpha precursor Wa1 Waved 1 |
Description | Recombinant Human TGF alpha Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA |
Molecular Weight | 6 kDa |
Purity | >95% SDS-PAGE.Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -80°C. |