Recombinant Human TGFBI Protein
Beta LifeScience
SKU/CAT #: BLA-1986P
Recombinant Human TGFBI Protein
Beta LifeScience
SKU/CAT #: BLA-1986P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | RGD containing collagen associated protein AI181842 AI747162 Beta ig Beta ig h3 Beta ig-h3 BGH3_HUMAN Big h3 BIGH3 CDB1 CDG2 CDGG1 CSD CSD1 CSD2 CSD3 EBMD Kerato epithelin Kerato-epithelin LCD1 MGC150270 RGD CAP RGD-CAP RGD-containing collagen-associated protein TGFBI TGFBI transforming growth factor, beta induced, 68kDa Transforming growth factor beta induced protein ig h3 Transforming growth factor-beta-induced protein ig-h3 |
Description | Recombinant Human TGFBI Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MGTVMDVLKGDNRFSMLVAAIQSAGLTETLNREGVYTVFAPTNEAFRA LPPRERSRLLGDAKELANILKYHIGDEILVSGGIGALVRLKSLQGDKL EVSLKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPA |
Purity | >95% SDS-PAGE.This protein was purified by using conventional chromatography techniques |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycle. |