Recombinant Human TGFBRAP1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-1989P
Recombinant Human TGFBRAP1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-1989P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | NP_004248 |
Synonym | TGF-beta receptor-associated protein 1 TGFA1_HUMAN Tgfbrap1 Transforming growth factor-beta receptor-associated protein 1 TRAP-1 TRAP1 VPS3 |
Description | Recombinant Human TGFBRAP1 Protein (His tag) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | RGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSKRLQKEEYHTHLAVL YLEEVLLQRASASGKGAEATETQAKLRRLLQKSDLYRVHFLLERLQGAGL PMESAILHGKLGEHEKALHILVHELQDFAAAEDYCLWCSEGRDPPHRQQL FHTLLAIYLHAGPTAHELAVAAVDLLNRHATEFDAAQVLQMLPDTWSVQL LCPFLMGAMRDSIHARRTMQVALGLARSENLIYTYDKMKLKGSSIQLSDK KLCQICQNPFCEPVFVRYPNGGLVHTHCAASRHTNPSSSSPGTRT |
Molecular Weight | 33 kDa including tags |
Purity | Greater than 80% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |