Recombinant Human TNF Receptor II Protein
Beta LifeScience
SKU/CAT #: BLA-1145P
Recombinant Human TNF Receptor II Protein
Beta LifeScience
SKU/CAT #: BLA-1145P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P20333 |
Synonym | CD120b p75 p75 TNF receptor p75TNFR p80 TNF alpha receptor p80 TNF-alpha receptor Soluble TNFR1B variant 1 TBP-2 TBPII TNF R II TNF R2 TNF R75 TNF-R2 TNF-RII TNFBR TNFR-II TNFR1B TNFR2 TNFR80 TNFRII Tnfrsf1b TNR1B_HUMAN Tumor necrosis factor beta receptor Tumor necrosis factor binding protein 2 Tumor necrosis factor receptor 2 Tumor necrosis factor receptor superfamily member 1B Tumor necrosis factor receptor type II Tumor necrosis factor-binding protein 2 |
Description | Recombinant Human TNF Receptor II Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSD TVCDSCEDST YTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQE GCRLCAPLRK CRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPG NASMDAVCTS TSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAE GSTGD |
Molecular Weight | 26 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Measured by its ability to inhibit TNFa mediated cytotoxicity in L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D.The ED50 for this effect is typically 0.05-0.5 µg/mL in the presence of 0.25 ng/mL recombinant Human TNFa. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. After reconstitution store at -20°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity. |
Subcellular Location | [Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.; [Tumor necrosis factor-binding protein 2]: Secreted. |
Database References |
Gene Functions References
- TL1A modulated Rheumatoid arthritis-fibroblast-like synoviocytes migration and Indian hedgehog signaling pathway using TNFR2. PMID: 29748156
- Data suggest that maternal glycemic response during pregnancy is associated with lower DNA methylation of 4 CpG sites within PDE4B gene in placenta (collected after normal-weight term birth); 3 additional CpG sites are differentially methylated relative to maternal glucose response within TNFRSF1B, LDLR, and BLM genes. (PDE4B = phosphodiesterase-4B; LDLR = low density lipoprotein receptor; BLM = Bloom syndrome protein) PMID: 29752424
- serum level did not change after tonsillectomy alone but decreased significantly after steroid pulse therapy in patients with IgA nephropathy PMID: 28389814
- Elevated serum TNFR2 may be a possible marker of COPD in asymptomatic smokers and ex-smokers. PMID: 28744116
- TNFR2 promoted Adriamycin resistance in breast cancer cells by regulating the DNA damage repair. PMID: 28677724
- Serum TNFR2 is a biomarker for patients with chronic kidney disease. PMID: 28667032
- Data indicate activators of tumor necrosis factor receptor 2 (TNFR2) and a potential role for this target in immunotherapy. PMID: 27626702
- In this study, we identified a novel association between ANCA levels, TNFRSF1B genotype and decreased circulating TNFR2 levels, which may be reflective of the underlying biological mechanisms that determine clinical expression and/or response to certain therapies. PMID: 27104820
- In Han Chinese population of Hunan province, TNFRSF1B+676 gene polymorphisms are not associated with the genetic risk of rheumatoid arthritis PMID: 27640805
- Results showed that TNFR2 was upregulated in papillary thyroid carcinoma tissues, and its expression is regulated by H19. PMID: 29287713
- The TNFRSF1Brs3397 variant may play a role in modulating the risk of rheumatoid arthritis, but does not provide strong evidence of an impact of TNFRSF1B variants in determining response to anti-TNF drugs. PMID: 25850964
- atopic dermatits patients had increased TNFR2 expression on immune cells PMID: 29212072
- the blocking of tumor necrosis factor receptor 2 (TNFR2) decreased TL1A-stimulated IL-6 production by rheumatoid arthritis fibroblast-like synoviocytes. PMID: 27081759
- Data suggest that, by targeting tumor cells and immunosuppressive tumor-associated Tregs, antagonistic tumor necrosis factor receptor 2 (TNFR2) antibodies may be an effective treatment for cancers positive for TNFR2. PMID: 28096513
- p75 neurotrophin receptor (p75TNFR) was the first NGFR (nerve growth factor receptor) to be cloned and the founding member of the TNFR (tumor necrosis factor receptor) superfamily. However, data suggest that p75TNF is an atypical TNFR superfamily protein; p75TNFR forms dimers (activated by dimeric neurotrophins) that are structurally unrelated to TNFR superfamily proteins. [REVIEW] PMID: 28215307
- High plasma levels of TNFR2 and TNFR1 were associated with incident intracerebral hemorrhage. PMID: 28830973
- Serum TNFR2 levels were elevated in lupus nephritis patients versus controls. PMID: 27973968
- Voxel-based morphometry was used to analyse the associations between TNFRSF1B (rs1061624) genotypes and grey matter structure. Analysis of the TNFRSF1B SNP rs1061624 yielded a significant association with hippocampal but not with striatal volume, whereby G homozygotes were associated with increased volumes relative to A homozygotes and heterozygotes. PMID: 27528091
- Our results demonstrated that Treg frequencies and TNFR2 expression on Tregs are increased in sarcoidosis, followed by a decline during infliximab therapy, suggesting a pathophysiological role of this T cell subset. PMID: 27158798
- identified 6 known and 4 novel variations in 6 different exons of TNFR2 gene; out of these identified variations, 5 known variations were found to be significantly associated with the risk of cervical cancer; postmenopausal women having CAAGC + CTGCC haplotypes in TNFR2 gene along with HPV infection and tobacco consumption may lead to the development of cervical cancer PMID: 27145290
- LTbetaR is essential for efficient liver regeneration and cooperates with TNFRp55 in this process. Differences in survival kinetics strongly suggest distinct functions for these two cytokine receptors in liver regeneration. PMID: 26708145
- that U87-p75(NTR) cells express higher levels of Cdh-11 protein and that siRNA-mediated knockdown of Cdh-11 resulted in a significant decrease in p75(NTR)-mediated glioblastoma cell migration PMID: 26476273
- TNF-alpha/TNFR2 regulatory axis stimulates EphB2-mediated neuroregeneration via activation of NF-kappaB. PMID: 26492598
- This meta-analysis demonstrates that TNFRSF1B T allele carriers show a better response to anti-TNF therapy--{REVIEW} PMID: 26071216
- Pretransplant recipient circulating CD4+CD127lo/-TNFR2+ Treg cell is potentially a simpler alternative to Treg cell function as a pretransplant recipient immune marker for acute kidney injury. PMID: 26425877
- NGF has a role in modulating trkANGFR/p75NTR in alphaSMA-expressing conjunctival fibroblasts from human ocular cicatricial pemphigoid PMID: 26569118
- our findings implicate TNFR2 in supporting myeloid-derived suppressor cells -mediated immune suppression and metastasis in the liver PMID: 26483205
- In conclusion, we report a significant association between the TNFRSF1B p.M196R variant and the risk for psoriasis and the response to treatment with anti-TNF or anti-Il-12/Il-23. PMID: 25537528
- Plasma sTNFR2 was higher during pregnancy compared with controls. Urinary levels of sTNFR2 were higher in preeclampsia and pregnant women compared with controls. PMID: 25034210
- study suggests that TNFR2(+) Tregs play a role in promoting tumor progressive metastasis PMID: 26280204
- Recurrent point mutations and genomic gains of TNFRSF1B, encoding the tumor necrosis factor receptor TNFR2, are present in a subset of patients with mycosis fungoides and Sezary syndrome. PMID: 26258847
- Increased plasma level of sTNFRII is found to be associated with exudative age-related macular degeneration. PMID: 25363549
- ADAM17 was identified as the protease responsible for TNFR2 shedding by CD8(+) T cells, with ADAM17 and TNFR2 required in "cis" for shedding to occur. PMID: 26019295
- hTNFR2 blocks the biological activity of lymphotoxin beta. PMID: 25940088
- NRH2 enhanced the ratio of Bax/Bcl-2 by promoting the expressions of proNGF, sortilin and p75NTR, thereby inducing brain cell apoptosis. PMID: 25854576
- Only TNFR2 can induce TRAF2 degradation. PMID: 25152365
- Data show that TNF-alpha receptor TNFR2 mRNA expression was significantly increased after 6, 9 and 12 hours of poly (I:C) stimulation. PMID: 25419735
- Functional TNFR2 196 M/R polymorphism is associated with susceptibility to rheumatoid arthritis in the European population. PMID: 24777778
- Serum TNFR2 is associated with renal decline and ESRD risk in type 1 diabetes and proteinuria. PMID: 24898299
- The TNFRII nt587 G/G genotype may increase the risk of developing AS in the Chinese population. PMID: 25061744
- High TNF receptor 2 is closely associated with the loss of kidney function. PMID: 24717758
- Inflammation mediated through TNFalpha and its receptors, TNFR1 and TNFR2, may represent an important component of a comorbidity-induced inflammatory response that partially drives the pathophysiology of heart failure (HF) with preserved ejection fraction. PMID: 24923671
- TNF-TNFR2 signaling may induce RBR in naive BM-EPCs and that blocking TNF-TNFR2 signaling may prevent delayed RBR in BM-EPCs, conceivably, in bone marrow milieu in general PMID: 24711449
- Blood levels of CRP, IL-6 and TNFalpha-R2 are not associated with incident depression. PMID: 24836084
- Addition of leukemia inhibitory factor (LIF) neutralizing antibodies inhibited oligodendrocyte differentiation, indicating a crucial role of TNFR2-induced astrocyte derived LIF for oligodendrocyte maturation PMID: 24310780
- Higher plasma TNFR75 levels were associated with decreased time to first COPD exacerbatino in a prospective study. PMID: 24136332
- Our results support a role of TNFRSF1B gene variants in the response to IFX in CD patients. PMID: 24121042
- Serum TNFR2 expression levels might be a powerful prognostic factor for patients treated with the R-CHOP regimen. PMID: 23672298
- Release of nonmuscle myosin II from the cytosolic domain of tumor necrosis factor receptor 2 is required for target gene expression. PMID: 23861542
- genetic association studies in a population of women in Tunisia: Data suggest that an SNP in exon 6 of TNFR2/TNFRSF1B (rs1061622) is associated with pre-eclampsia. PMID: 23799986