Recombinant Human TPOR/MPL Protein (His tag)

Name: Recombinant Human TPOR/MPL Protein (His tag)
Brand: Beta LifeScience
SKU: BLA-1165P
Availability: InStock

Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	P40238
Synonym	C MPL CD110 mpl MPLV Myeloproliferative leukemia protein Myeloproliferative leukemia virus oncogene Proto-oncogene c-Mpl THCYT2 Thrombopoietin receptor TPO R TPO-R TPOR TPOR_HUMAN
Description	Recombinant Human TPOR/MPL Protein (His tag) was expressed in E.coli. It is a Protein fragment
Source	E.coli
AA Sequence	QDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPSGTYQLLYAYPREKPR ACPLSSQSMPHFGTRYVCQFPDQEEVRLFFPLHLWVKNVFLNQTRTQRVL FVDSVGLPAPPSIIKAMGGSQPGELQISWEEPAPEISDFLRYELRYGPRD PKNSTGPTVIQLIATETCCPALQRPHSASALDQSPCAQPTMPWQDGPKQT SPSREASALTAEGGSCLISGLQPGNSYWLQLRSEPDGISLGGSWGSWSLP VTVDLPGDAVALGLQCFTLDLKNVTCQWQQQDHASSQGFFYHSRARCCPR DRYPIWENCEEEEKTNPGLQTPQFSRCHFKSRNDSIIHILVEVTTAPGTV HSYLGSPFWIHQAVRLPTPNLHWREISSGHLELEWQHPSSWAAQETCYQL RYTGEGHQDWKVLEPPLGARGGTLELRPRSRYRLQLRARLNGPTYQGPWS SWSDPTRVETATETAW
Molecular Weight	57 kDa including tags
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Receptor for thrombopoietin that acts as a primary regulator of megakaryopoiesis and platelet production. May represent a regulatory molecule specific for TPO-R-dependent immune responses.
Subcellular Location	Cell membrane; Single-pass type I membrane protein. Golgi apparatus. Cell surface.
Protein Families	Type I cytokine receptor family, Type 1 subfamily
Database References	HGNC: 7217 OMIM: 159530 KEGG: hsa:4352 STRING: 9606.ENSP00000361548 UniGene: Hs.82906
Associated Diseases	Congenital amegakaryocytic thrombocytopenia (CAMT); Thrombocythemia 2 (THCYT2); Myelofibrosis with myeloid metaplasia (MMM)
Tissue Specificity	Expressed at a low level in a large number of cells of hematopoietic origin. Isoform 1 and isoform 2 are always found to be coexpressed.

Gene Functions References

JAK2V617F mutation was found in 37 (61.7%) patients with ET. Among 23 patients without JAK2V617F mutation, 7 (11.7%) had CALR mutation and 1 (1.7%) had MPL mutation. Fifteen (25.0%) patients were negative for all 3 mutations: JAK2V617F(-), CALR(-), and MPL(-). PMID: 29390868
MPL and CALR genotypes show a similar clinical picture at essential thrombocythaemia diagnosis. Bone marrow histology in MPL-mutated ET is characterized by prominent megakaryocytic proliferation. PMID: 29934356
These results indicate that lusutrombopag acts on human TPOR to upregulate differentiation and proliferation of megakaryocytic cells, leading to platelet production. PMID: 29274361
The expression of TPO and c-Mpl was significantly decreased in the cITP group compared to the nITP group, suggesting that TPO and its receptor may play important roles in childhood cITP pathogenesis. PMID: 29313460
A novel germ-line mutation of c-mpl gene in a sporadic case of essential thrombocythemia. PMID: 28391042
This study demonstrated that absence of MPL mutation in stroke. PMID: 28625126
MPL mutations and splenomegaly are risk factors for essential thrombocythemia progression into primary nyelofibrosis. PMID: 27768091
goals were: (i) to identify other MPL mutations that should be tested in MPN patients by mutation-specific PCR; and (ii) to determine the amino acid requirements at position 515 to prevent TpoR self-activation PMID: 26437785
Concurrent MPL W515L and Y591D mutations in a patient with myelofibrosis. PMID: 27519934
MPL is up regulated in JAK2(V617F) ECs and contributes to the maintenance/expansion of the JAK2(V617F) clone over JAK2(WT) clone in vitro PMID: 27865175
In tumor cell cultures, exogenous expression of MPL led to constitutive activation of STAT3 and 5, ERK1/2, and AKT, cytokine-independent growth, and reduction of apoptosis similar to the effects seen in the spontaneously outgrown cells. PMID: 27177927
Essential Thrombocythemia and Primary Myelofibrosis patients with MPL mutations are at high risk for Thrombotic Events. PMID: 28766534
Results show that mutant CALR induces autocrine, but not paracrine activation of MPL in myeloproliferative neoplasm. [review] PMID: 28741795
these results demonstrate that MPL P106L is a receptor with an incomplete defect in trafficking. PMID: 28034873
A newborn girl with congenitcal amegakaryocytic thrombocytopenia had a homozygous missense Trp154-to- Arg mutation in exon 4 of c-MPL. The same heterozygote mutation was detected in her mother, father, and 2 siblings. PMID: 26316487
Normal FLT3 and negative expression of CD34 and cMPL may predict a longer overall survival in aute myeloid leukemia. PMID: 27993871
we show that the positive charge of the CALR mutant C-terminus is necessary to transform hematopoietic cells by enabling binding between mutant CALR and the thrombopoietin receptor MPL. PMID: 26951227
In essential thrombocythemia, MPL mutations might be associated with a higher risk of fibrotic transformation and the presence of JAK2/MPL mutations with higher risk of thrombosis. PMID: 26890983
PARP-1 has an important role in the progression of acute myeloid leukemia by suppressing the myeloproliferative leukemia virus oncogene PMID: 26314963
mutant CALR promotes myeloproliferative neoplasm development by activating c-MPL and its downstream pathway. PMID: 26817954
Thrombopoietin receptor activation by myeloproliferative neoplasm associated calreticulin mutants. PMID: 26668133
we describe a Mpl W515K somatic mutation in a paediatric case of ET who presented with Budd-Chiari syndrome. No paediatric patient harbouring a Mpl W515K mutation has been previously reported. PMID: 25970554
His(499) regulates the activation of human TpoR and provides additional protection against activating mutations, such as oncogenic Asn mutations in the TM domain PMID: 26627830
this study has shown that in a fraction of the so-called triple-negative ETs a significant proportion of patients have mutations in signaling molecules, more particularly in MPL. PMID: 26450985
erythrocyte lineage enforces exclusivity through upregulation of EKLF and its lineage-specific cytokine receptor (EpoR) while inhibiting both FLI-1 and the receptor TpoR (also known as MPL) for the opposing megakaryocyte lineage PMID: 26159733
Compared to normal controls, the frequency of the JAK246/1 haplotype was significantly higher among patients with JAK2V617F, JAK2Ex12del, or MPL mutations, whereas no significant difference was found among CALR mutation-positive patients PMID: 26614694
Flow cytometric detection of MPL (CD110) as a diagnostic tool for differentiation of congenital thrombocytopenias. PMID: 25911549
Using C-mannosylation defective mutant of c-Mpl, the C-mannosylated tryptophan residues at four sites (Trp(269), Trp(272), Trp(474), and Trp(477)) are essential for c-Mpl-mediated JAK-STAT signaling. PMID: 26505790
MPL gene mutations are associated with essential thrombocythaemia and major thrombotic complications. PMID: 25573593
Letter/Meta-analysis: thrombopoietin receptor agonists significantly increase the risk of portal vein thrombosis in liver diseases. PMID: 25761530
MPL mutation is associated with myeloproliferative neoplasms. PMID: 25398833
The effects of inhibition of the TPO/c-MPL pathway on enhancing the chemotherapy sensitivity of AML cells. PMID: 24085601
The data supports the proposal of including MPL exon 10 mutations as major diagnostic markers for myeloproliferative neoplasms. PMID: 26071474
CALR mutation, MPL mutation and triple negativity may have roles in lowering vascular risk in primary myelofibrosis PMID: 25482134
Both immature and mature Mpl reach the cell surface. PMID: 24931576
The P106L mutation functionally separates The activity of c-Mpl in downstream signaling from that in maintaining platelet homeostasis. PMID: 25538044
Amino acid substitutions in a thrombopoietin receptor (Mpl)--containing cell growth switch (CGS) extending receptor stability improve the expansion capacity of human cord blood CD34(+) cells in the absence of exogenous cytokines. PMID: 25343958
OTT1 regulates the alternative splicing of Mpl-TR, a truncated isoform of c-Mpl, which modulates Thrombopoietin-mediated signaling. PMID: 25468569
Studies demonstrate that progression to AML is part of the natural history of MPL W515L-associated disease. PMID: 20823136
Impaired transcriptional regulation of the MPL signaling that normally governs megakaryopoiesis and erythropoiesis underlies congenital amegakaryocytic thrombocytopenia. PMID: 23908116
These experiments define a novel VEGF-miR-1-Mpl-P-selectin effector pathway in lung Th2 inflammation and herald the utility of miR-1 and Mpl as potential therapeutic targets for asthma. PMID: 24043765
In migrating cancer stem cells isolated from primary human colorectal cancers, CD110(+) and CDCP1(+) subpopulations mediate organ-specific lung and liver metastasis. PMID: 23747337
MPL W515L mutation in pediatric essential thrombocythemia. PMID: 23441089
Different mutations of the human c-mpl gene indicate distinct hematopoietic diseases. PMID: 23351976
Loss of heterozygosity of chromosome 1p involving the MPL location may represent a molecular mechanism of fibrotic transformation in MPL-mutated myeloproliferative neoplasms. PMID: 23575445
MPL Baltimore mutation is associated with thrombocytosis. PMID: 23511495
Tryptophan at the transmembrane-cytosolic junction modulates thrombopoietin receptor dimerization and activation. PMID: 23359689
Up-regulation of wild-type MPL levels promotes leukemia development and maintenance through activation of the PI3K/AKT axis. PMID: 22613795
High MPL expression is associated with leukemia. PMID: 22337712
This study shows for the first time a link between homozygous MPL mutations and familial aplastic anemia. It also highlights the important role of MPL in trilineage hematopoiesis. PMID: 22180433

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.