Recombinant Human TRAP/CD40L Protein (Soluble)
Beta LifeScience
SKU/CAT #: BLA-11167P
Recombinant Human TRAP/CD40L Protein (Soluble)
Beta LifeScience
SKU/CAT #: BLA-11167P
Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Car-nk targets proteins, Cluster of differentiation (cd) proteins, Co-stimulatory receptors, Cytokines and growth factors, Featured cd protein molecules, Recombinant proteins, Tumor necrosis factors and receptors (tnfs)
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P29965 |
Synonym | CD 40L CD154 CD40 antigen ligand CD40 ligand CD40 ligand, soluble form CD40-L CD40L CD40L_HUMAN CD40LG gp39 hCD40L HIGM1 IGM IMD3 T B cell activating molecule T BAM T-cell antigen Gp39 TNF-related activation protein TNFSF5 TrAP Tumor necrosis factor (ligand) superfamily member 5 Tumor necrosis factor ligand superfamily member 5 |
Description | Recombinant Human TRAP/CD40L Protein (Soluble) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLT VKRQGLYYIYAQVTFCSNREASSQAPFIASLCLKSPGRFERILLRAANTH SSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL |
Molecular Weight | 16 kDa |
Purity | >95% SDS-PAGE.>98% by SDS-PAGE and HPLC analyses |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Biological Activity: Determined by the stimulation of IL-12 induction by human peripheral blood mononuclear cells (PBMC) and the stimulation of IL-8 induction by human PBMC. The expected ED50 for this effect is 5-10 ng/ml.Note: Results may vary with PBMC donors. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Cytokine that acts as a ligand to CD40/TNFRSF5. Costimulates T-cell proliferation and cytokine production. Its cross-linking on T-cells generates a costimulatory signal which enhances the production of IL4 and IL10 in conjunction with the TCR/CD3 ligation and CD28 costimulation. Induces the activation of NF-kappa-B. Induces the activation of kinases MAPK8 and PAK2 in T-cells. Induces tyrosine phosphorylation of isoform 3 of CD28. Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL4. Involved in immunoglobulin class switching.; Acts as a ligand for integrins, specifically ITGA5:ITGB1 and ITGAV:ITGB3; both integrins and the CD40 receptor are required for activation of CD40-CD40LG signaling, which have cell-type dependent effects, such as B-cell activation, NF-kappa-B signaling and anti-apoptotic signaling. |
Subcellular Location | Cell membrane; Single-pass type II membrane protein. Cell surface.; [CD40 ligand, soluble form]: Secreted. |
Protein Families | Tumor necrosis factor family |
Database References | |
Associated Diseases | Immunodeficiency with hyper-IgM, type 1 (HIGM1) |
Tissue Specificity | Specifically expressed on activated CD4+ T-lymphocytes. |
Gene Functions References
- this study reports the clinical and CD40L genetic features of six Iranian hyper IgM syndrome patients PMID: 30081731
- Overexpression of CD40L-WT/CD40L-M in CD40+ NSCLC cells increased SA-beta-gal staining activity and inhibited DNA synthesis and cell proliferation. PMID: 30078020
- T cell-stimulated CLL cells actively recruited monocytes, and CD40L was identified as the responsible T-cell factor that mediated recruitment. PMID: 28971904
- this study shows that decreased serum levels of soluble CD40L correlate in treated patients with Relapsing-Remitting Multiple Sclerosis PMID: 29050818
- In conclusion, we described a new pathway of platelet-monocyte interaction, mediated by sCD40L and oxidative stress that may contribute to the progression of endothelial dysfunction during Shiga toxin 2-associated hemolytic uremic syndrome. PMID: 29068360
- show that sCD40L/alpha5beta1 interaction leads to platelet activation as evaluated in the human whole blood PMID: 26719354
- In this first X chromosome-wide association study of adult patients with IBD, we identified an IBD susceptibility locus with genome-wide significance at rs2427870 on chrXq26.3, located 66 kbp upstream of CD40LG and 83.4 kbp upstream of ARHGEF6 [OR, 1.22; combined p = 3.79 x 10-15]. PMID: 28333213
- Study indicates that the rs1126535C/T polymorphism of CD154 gene was involved in the progression of Chinese SLE patients, probably by affecting the expression of CD154. PMID: 28550400
- study found that plasma CD40L was associated with acute chest syndrome (ACS), and that sickle cell anemia (SCA)patients with a lifetime history of ACS (ACS+) presented significantly higher plasma CD40L and TSP-1 than patients who had never experienced ACS (ACS-) PMID: 28609750
- this paper demonstrates importance of CD40/CD40L signaling on IL-10-producing regulatory B cells in Chinese children with Henoch-Schonlein purpura nephritis PMID: 27837410
- Soluble CD40 ligand derived from serum is not correlated with early stage of multiple sclerosis. PMID: 28619427
- Analysis of the early events after receptor engagement revealed that both TNF and CD40L activate the classical NF-kappaB pathway, and confirm activation of the alternative by the latter. Furthermore, using genetic and pharmacological inhibition of the classical pathway we show that activation of the alternative occurs independently of the former. This reveals insights into NF-kappaB signaling by CD40L and TNF in endoth... PMID: 29183724
- CD40L, more than IL-6, or TNF-alpha, constitutes a predictor to explain polycystic ovary syndrome and associated features PMID: 27572328
- Soluble CD40 ligand directly alters glomerular permeability and may act as a circulating permeability factor in focal segmental glomerulosclerosis. PMID: 29155846
- Plasma sCD40L levels were elevated in systemic lupus erythematosis patients who had positive anti-phospholipid antibodies and experienced arterial thrombosis, suggesting that enhanced release of sCD40L through platelet activation presumably by aPL could contribute to the development of atherothrombotic disease. PMID: 28421990
- Higher concentrations of CD40L in patients with limited cutaneous form in our study might suggest a role for CD40/CD40L pathway in vascular pathology of systemic sclerosis. PMID: 27392528
- we also report for the first time that the rs1126535 C allele (CD40L gene) may predict a worse response after gastric bypass in morbidly obese patients PMID: 27681093
- Serum levels of sCD40L and MMP-9 are associated with the stability of carotid plaques. PMID: 28642174
- studies identify a novel molecular mechanism of regulation of CD40L by the transcription factor GLI2 in the tumor microenvironment downstream of CCR3 signaling PMID: 28461568
- data suggest that therapeutic CD40-CD40L blocking agents may prove efficacious not only in early and established rheumatoid arthritis (RA), but also in inhibiting the progression of the disease from arthralgia or undifferentiated arthritis to RA PMID: 28455435
- CD4(+) T cells that coexpress CD57 and CD154, which are exclusively present in cytomegalovirus-positive individuals. PMID: 27566833
- Serum CD40L levels were elevated in both neuromyelitis optica and multiple sclerosis patients. PMID: 27725124
- plasma PGE2 is correlated with the prevention of IVIG resistance and CAL formation through CD40L in KD PMID: 27525421
- This study provides the first evidence that human circulating group 2 innate lymphoid cells can express CD154 and stimulate the production of IgE by B lymphocytes through IL-25/IL-33 stimulation or TLR triggering PMID: 27576126
- data also demonstrated that the CD154-triggered inhibition of the Fas-mediated cell death response was dependent on a suppression of caspase-8 cleavage, but independent of de novo protein synthesis or alterations in Fas expression on cell surface. PMID: 27391025
- These results suggest soluble CD40L could have a prognostic value in ST-elevation myocardial infarction patients. PMID: 27172386
- persistence of helper T-cell-derived CD40L on or in B cells could permit sustained CD40 signaling enabling survival and proliferation of antigen-presenting B cells following brief interactions with helper T cells in vivo in germinal centers. PMID: 27753080
- These results demonstrate the feasibility of engineered nuclease-directed gene repair to restore endogenously regulated CD40L, and the potential for its use in T-cell therapy for X-HIGM syndrome. PMID: 26903548
- Hypertensives showed significantly enhanced soluble CD40L levels compared to normotensive controls PMID: 27090943
- The levels of sCD40l have no influence on survival or cardiovascular events and mortality in haemodialysis patients in a long-term follow-up PMID: 27295448
- CD40L gene polymorphism was found to be associated with severe falciparum malaria in Indian population especially in severe malarial anaemia. PMID: 28352049
- While CD40 expression tends to be relatively high in the peritumoral dermis of epithelial carcinomas, the expression of CD40L in mast cells is low in the same peritumoral area, compared with the opposite findings in psoriasis and actinic keratosis. PMID: 28267402
- Increased serum sCD40L levels may be related to angiogenesis in patients with multiple myeloma (MM). This protein has potential clinical usefulness in MM and may be considered as an additional prognostic marker. The correlation of sCD40L with beta-thromboglobulin may indicate that in patients with MM sCD40L derives from activated platelets. PMID: 27243341
- Primary Aldosteronism is related to platelet activation, expressed as higher plasma values of soluble CD40L and soluble P-selectin values. PMID: 27101095
- Given the crucial role of sCD40L, this haplotype study in a transfusion model may be helpful to further determine the role of haplotypes in inflammatory clinical settings. PMID: 27094978
- Overexpression of CD154 on CD4(+)T cells is unlikely to be central to the pathogenesis of idopathic thrombocytopenic purpura, and other immune dysfunctions should be targeted for therapy purposes. PMID: 26183367
- the serum levels of the soluble factors sCD40L and CXCL1 are not associated with endometriosis and are not suitable as biomarkers for disease diagnosis. PMID: 27190986
- Increased sCD40L plasma levels are associated with the presence of insulin resistance and not the state of glucose tolerance. PMID: 26934129
- we report that Kv1.3-NPs reduced NFAT activation and CD40L expression exclusively in CD45RO(+) T cells. Furthermore, Kv1.3-NPs suppressed cytokine release and induced a phenotype switch of T cells from predominantly memory to naive. PMID: 26994905
- mCD40L-induced cell death mediated by NORE1A expression appeared to be independent of mCD40L-induced cell death mediated by sustained JNK activation since NORE1A inhibition did not affect JNK phosphorylation and vice versa PMID: 26986513
- diagnostic value of soluble CD40 ligand (sCD40L) and vascular endothelial growth factor (VEGF) for Alzheimer's disease PMID: 26706786
- Study allows identify significant different genetic heterogeneity between two investigated populations (France and Tunisia) and revealed discrepancies in the prevalence of CD40LG polymorphisms that may be explained by ethnic and geographic differences. PMID: 26577033
- concentrations of the C-reactive protein, myeloperoxidase and soluble CD40 ligand taken from peripheral vein were closely similar to the concentration found in coronary blood of ACS patients PMID: 26576922
- Studies suggest that the CD40/CD154 pathway represents a promising potential therapeutic target for the prevention of transplantation rejection. PMID: 26268734
- Three single-nucleotide polymorphisms (SNPs) of the TLR8, CD40LG and IRAK1 genes on the X chromosome were genotyped. PMID: 26043172
- plasma soluble CD40L levels are reduced by antiplatelet therapy with clopidogrel, but not associated with long-term ischemic outcomes in unselected consecutive aspirin-treated patients undergoing cardiac catheterization. PMID: 26237513
- The study findings showed that plasma sCD40L, fetuin-A, and PAPP-A levels are associated with carotid plaque formation and instability. PMID: 26214492
- CD40 ligand induces RIP1-dependent, necroptosis-like cell death in low-grade serous but not serous borderline ovarian tumor cells. PMID: 26313915
- CD40 ligand induces von Willebrand factor release from endothelial cells PMID: 25608503
- Higher plasma soluble CD40L levels on presentation are associated with clinical severity and have potential to be a good prognostic biomarker of aneurysmal subarachnoid hemorrhage. PMID: 25944664