Recombinant Human TRAP220/MED1 Protein
Beta LifeScience
SKU/CAT #: BLA-11170P
Recombinant Human TRAP220/MED1 Protein
Beta LifeScience
SKU/CAT #: BLA-11170P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | Activator-recruited cofactor 205 kDa component ARC205 CRSP1 CRSP200 DRIP205 DRIP230 MED1 MED1_HUMAN Mediator complex subunit 1 Mediator of RNA polymerase II transcription subunit 1 p53 regulatory protein RB18A PBP Peroxisome proliferator-activated receptor-binding protein PPAR binding protein PPAR-binding protein PPARBP PPARGBP RB18A Thyroid hormone receptor-associated protein complex 220 kDa component Thyroid receptor-interacting protein 2 TR-interacting protein 2 Trap220 TRIP-2 TRIP2 Vitamin D receptor-interacting protein complex component DRIP205 |
Description | Recombinant Human TRAP220/MED1 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | KIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGST PKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLP |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |