Recombinant Human TRAPPC2 Protein
Beta LifeScience
SKU/CAT #: BLA-11172P
Recombinant Human TRAPPC2 Protein
Beta LifeScience
SKU/CAT #: BLA-11172P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P0DI81 |
Synonym | hYP38334 MBP 1 interacting protein 2A MBP-1-interacting protein 2A MIP 2A MIP-2A MIP2A SEDL Sedlin SEDLP SEDT Spondyloepiphyseal dysplasia tarda protein Spondyloepiphyseal dysplasia, late TPPC2_HUMAN Trafficking protein particle complex 2 Trafficking protein particle complex subunit 2 TRAPPC2P1 TRS20 ZNF547L |
Description | Recombinant Human TRAPPC2 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMSGSFYFVIVGHHDNPVFEMEFLPAGK AESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAFVT AGHMRFIMLHDIRQEDGIKNFFTDVYDLYIKFSMNPFYEPNSPIRSSAFD RKVQFLGKKHLLS |
Molecular Weight | 19 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |