Recombinant Human TRAPPC4 Protein
Beta LifeScience
SKU/CAT #: BLA-11174P
Recombinant Human TRAPPC4 Protein
Beta LifeScience
SKU/CAT #: BLA-11174P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9Y296 |
Synonym | CGI 104 Hematopoietic stem/progenitor cell protein 172 HSPC172 PTD009 SBDN Synbindin Trafficking protein particle complex subunit 4 TRAPPC4 TRS23 TRS23 homolog |
Description | Recombinant Human TRAPPC4 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMAIFSVYVVNKAGGLIYQLDSYAPRAE AEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGMDVNGRYTA DGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFAIGSQLSP EQGSSGIEMLETDTFKLHCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIY SDFALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGTFGPGS |
Molecular Weight | 27 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |