Recombinant Human Trefoil Factor 1 (TFF1) Protein (His)

Name: Recombinant Human Trefoil Factor 1 (TFF1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-08203P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Cytokines, Cytokines and growth factors, Growth factors and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Trefoil Factor 1 (TFF1) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P04155
Target Symbol	TFF1
Synonyms	BCEI; Breast cancer estrogen inducible protein; Breast cancer estrogen inducible sequence; Breast cancer estrogen-inducible protein; D21S21; Gastrointestinal trefoil protein; Gastrointestinal trefoil protein pS2; hP1.A; HP1A; HPS 2; HPS2; pNR 2; PNR-2; pNR2; Polypeptide P1.A; Protein pS2; PS 2; pS2; pS2 protein; TFF 1; TFF1; TFF1_HUMAN; Trefoil factor 1
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
Expression Range	25-84aa
Protein Length	Full Length of Mature Protein
Mol. Weight	8.7kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Stabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents. May inhibit the growth of calcium oxalate crystals in urine.
Subcellular Location	Secreted.
Database References	HGNC: 11755 OMIM: 113710 KEGG: hsa:7031 STRING: 9606.ENSP00000291527 UniGene: Hs.162807
Tissue Specificity	Found in stomach, with highest levels in the upper gastric mucosal cells (at protein level). Detected in goblet cells of the small and large intestine and rectum, small submucosal glands in the esophagus, mucous acini of the sublingual gland, submucosal g

Gene Functions References

Findings suggest that the hypoxic conditions, which can be induced by gastric injury, promote TFF1 up-regulation, strengthened by an auto-induction mechanism, and that the trefoil peptide takes part in the epithelial-mesenchymal transition events eventually triggered to repair the damage. PMID: 29997345
The urine TFF1 and TFF3 levels significantly increased with the progression of chronic kidney disease stages, but not the urine TFF2 levels. PMID: 29850501
Study shows that TFF1 expression is silenced in early phases of esophageal squamous cell carcinoma (ESCC) development, which seems to be mediated at least in part by promoter hypermethylation, and provides the basis for the use of TFF1 expression as a potential biomarker for early ESCC detection. PMID: 29296124
these data suggest that TFF1 might help cells to counteract Helicobacter colonization and the development of a chronic inflammation. PMID: 29085807
Co-expression of GKN2 and TFF1 massively suppressed the expression of positive cell cycle regulators and induced G1/S arrest, synergistically enhancing the inhibition of cell viability and proliferation of gastric cancer cells PMID: 28150071
The data suggest that the tumor suppressor activity of both RUNX1t1 and TFF1 are mechanistically connected to CEBPB and that cross-regulation between CEBPB-RUNX1t1-TFF1 plays an important role in gastric carcinogenesis. PMID: 27522676
Low TFF1 expression is associated with retinoblastoma. PMID: 28481041
The results suggest that the analysis of expression of MUC5AC and TFF1 may be useful for differentiating sessile serrated adenomas/polyps (SSA/Ps) from hyperplastic polyps (HPs). PMID: 28430953
TFF1 displays a distinct protein expression pattern in the developing of airway remodeling due to Sulfur mustard inhalation and plays an important role in maintaining the airway epithelium function PMID: 27921407
we found TFF1 plays an oncogenic role in mucinous ovarian cancer PMID: 26617749
These results show increased levels of TFF1 and TFF3 in Chronic Kidney Disease patients with a pronounced elevation of urinary TFF1 in lower Chronic Kidney Disease stages. PMID: 26390128
Loss of TFF1 could be a critical step in promoting the H. pylori-mediated oncogenic activation of beta-catenin and gastric tumorigenesis. PMID: 25980439
We have established a novel, three-protein biomarker panel that is able to detect patients with early-stage pancreatic cancer in urine specimens:LYVE-1, REG1A, and TFF1 were selected as candidate biomarkers PMID: 26240291
These findings suggest that the rs184432 and rs225359 polymorphisms in TFF1 have protective effects for GC and contribute to the development of GC in Korean individuals. PMID: 26240479
Findings underscore an important protective role of TFF1 in abrogating H. pylori-mediated inflammation, a crucial hallmark of gastric tumorigenesis. Loss of TFF1 expression could be an important step in H. pylori-mediated gastric carcinogenesis. PMID: 26372254
This study provides a potent tool of rTFF1 production to be applied in gastric damage protection and wound healing. The protein sources from B. choshinensis were more efficient than rTFF1 produced by E. coli PMID: 25990322
trefoil factor 1 demonstrated breast specificity but was inferior to mammaglobin and GATA protein binding 3 PMID: 26276775
Data indicate that microRNA miR218-5p negatively regulates trefoil factor 1 (TFF1) in an extracellular signal-regulated kinases Erk1/2-dependent manner. PMID: 25652124
Trefoil Factor 1 levels can influence copper excretion and copper related toxicity. PMID: 25486181
data clearly show that the expression of TFF3 in retinoblastoma cell lines is epigenetically regulated, whereas the level of TFF1 and TFF2 seems to be regulated by other or additional mechanisms PMID: 25199519
Western blot analysis data demonstrated that miR-504 abrogates TFF1-induced p53 protein expression and activity. PMID: 25015107
overexpressed in chronic rhinosinusitis without nasal polyps PMID: 24733740
Immunohistochemical expression of ERalpha, ERbeta, and TFF1 in type I and II ovarian tumors. PMID: 24162262
Determination of TFF1 status might identify patients at different risk for relapse and help in making decision on administering adjuvant therapy for early breast cancer patients during the first 3 years of follow-up. PMID: 24843314
Retinoblastoma cell lines with high TFF1 expression levels exhibited a selective down-regulation of cyclin-dependent kinase (CDK) 6, whereas CDK4 and CDK2 seem to be unaffected by TFF1 expression. PMID: 22983508
Piezo1 is a novel TFF1 binding protein that is important for TFF1-mediated cell migration in gastric cancer cells. PMID: 24798994
the C-terminus of TFF1, involved in the binding of copper, is also able to selectively bind H. pylori RF-LPS. PMID: 24236136
High TFF1 expression is associated with doxorubicininduced apoptosis resistance. PMID: 23836323
miRNA-423-5p negatively regulated the expression of TFF1 by binding to its 3'UTR and participated in proliferation/invasion-related processes via a TFF1-dependent manner in gastric cancer cells PMID: 24486742
TFF1 missense mutations seem to be a rare event in colorectal carcinogenesis. However, serum TFF1 levels were significantly elevated in patients with colorectal carcinoma. Serum TFF1 may be a potential useful marker for patients with colorectal carcinoma. PMID: 24503794
Analysis of TFF1 levels dynamics revealed that TFF1 levels kept steady state during the 5-day period. TFF1 levels were similar in patients with SIRS, sepsis and severe sepsis PMID: 23627615
MSK1 and MSK2 are required for maximal TFF 1 induction. PMID: 23675462
downregulation of TFF1 expression during gastric neoplastic transformation is associated with activation of the NF-kappaB pathway PMID: 23942618
TFF1 expression is silenced by DNA methylation and is associated with tumor invasion and a poor survival in gastric cancer patients. PMID: 23291975
Reduced expression of TFF1 and increased expression of TFF3 may play a role in the carcinogenesis of gastric cancer. PMID: 23329884
There is no direct molecular interaction between GKN1 and TFF1 in protein level in gastric cancer. PMID: 22842654
The capacity of TFF1 to enhance prostate cancer cell migration/invasion is mediated by transcriptional repression of E-CADHERIN. PMID: 23266572
The expression of TFF1 protein increases in gastric ulcer but decreases in gastric ulcerocancer. PMID: 22944057
Report TFF1 expression in normal/diseased pancreas. PMID: 22286382
Over-expression of TFF1 could promote apoptosis of three cell lines and inhibit proliferation but had no pronounced effect on cell cycle PMID: 22642590
gastrointestinal tract specific gene GDDR might inhibit gastric cancer growth in a TFF1 dependent manner. PMID: 21870107
PIMT may act as a co-activator in ERalpha-mediated transcription of TFF1 through its recruitment to the promoter via interacting with ERalpha. PMID: 22382029
TFF1 promoter methylation is identified as a potential early marker of esophageal squamous cell carcinoma (ESCC). PMID: 21946330
We found a statistically significant increased risk of gastric cancer associated with -394 TT genotypes PMID: 22093877
documented the extent and timing of TFF1 expression in pancreatic ductal adenocarcinoma PMID: 21747314
expression of TFF1 stimulated the migration and invasion in the four cell lines. Forced TFF1 expression in MCF10A, MDA-MB-231 and MCF7 cells did not modify anchorage-dependent or -independent cell proliferation PMID: 21358676
The TFF1 promoter is activated by serum depletion according to promoter reporter assays in HEK 293 cells. PMID: 20494980
TFF mRNA/protein expression is indicative of cholangiocarcinoma progression, but not predictive for histological sub-type or survival time. PMID: 21472131
Data show that genes overexpressed in breast carcinoma including TFF1, TFF3, FOXA1 and CA12. PMID: 20132413
loss of TFF1 leads to activation of IKK complex-regulated NF-kappaB transcription factors and is an important event in shaping the NF-kappaB-mediated inflammatory response during the progression to gastric tumorigenesis PMID: 21490402

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.