Recombinant Human Tropomyosin 3 + PDGFR beta fusion Protein
Beta LifeScience
SKU/CAT #: BLA-2007P
Recombinant Human Tropomyosin 3 + PDGFR beta fusion Protein
Beta LifeScience
SKU/CAT #: BLA-2007P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P06753P09619 |
Description | Recombinant Human Tropomyosin 3 + PDGFR beta fusion Protein was expressed in Baculovirus infected Sf9 cells. It is a Protein fragment |
Source | Baculovirus infected Sf9 cells |
AA Sequence | MMEAIKKKMQMLKLDKENALDRAEQAEAEQKQAEERSKQLEDELAAMQKK LKGTEDELDKYSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEEL DRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLK EAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEELKN VTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKL EKTIDDLE |
Purity | >70% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The specific activity ofthis protein was4.6 nmol/min/mg in akinase assay usinga IGF1Rtide synthetic peptide (KKKSPGEYVNIEFG) as substrate. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |