Recombinant Human Tumor-Associated Calcium Signal Transducer 2 (TACSTD2) Protein (hFc), Active
Recombinant Human Tumor-Associated Calcium Signal Transducer 2 (TACSTD2) Protein (hFc), Active
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
| Description | Recombinant Human Tumor-Associated Calcium Signal Transducer 2 (TACSTD2) Protein (hFc), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | Measured in cell activity assay using U937 cells. The EC50 for this effect is 190.2-298.6 ng/ml. |
| Uniprotkb | P09758 |
| Target Symbol | TACSTD2 |
| Synonyms | TACSTD2; GA733-1; M1S1; TROP2; Tumor-associated calcium signal transducer 2; Cell surface glycoprotein Trop-2; Membrane component chromosome 1 surface marker 1; Pancreatic carcinoma marker protein GA733-1 |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-hFc |
| Target Protein Sequence | HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT |
| Expression Range | 27-274aa |
| Protein Length | Partial |
| Mol. Weight | 56.8 kDa |
| Research Area | Cancer |
| Form | Liquid or Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | May function as a growth factor receptor. |
| Subcellular Location | Membrane; Single-pass type I membrane protein. |
| Protein Families | EPCAM family |
| Database References | HGNC: 11530 OMIM: 137290 KEGG: hsa:4070 STRING: 9606.ENSP00000360269 UniGene: PMID: 30098828 |

