Recombinant Human Tumor Necrosis Factor Alpha-Induced Protein 8 (TNFAIP8) Protein (GST)

Name: Recombinant Human Tumor Necrosis Factor Alpha-Induced Protein 8 (TNFAIP8) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-08314P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Cytokines, Cytokines and growth factors, Recombinant proteins, Tumor necrosis factors and receptors (tnfs)

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Tumor Necrosis Factor Alpha-Induced Protein 8 (TNFAIP8) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O95379
Target Symbol	TNFAIP8
Synonyms	GG2 1; Head and neck tumor and metastasis-related protein; MDC-3.13; NDED; NF-kappa-B-inducible DED-containing protein; SCC S2; SCC-S2; SCCS2; TFIP8_HUMAN; TNF alpha-induced protein 8; TNF induced protein; TNF-induced protein GG2-1; TNFAIP 8; TNFAIP8; Tumor necrosis factor alpha induced protein 8; Tumor necrosis factor alpha-induced protein 8
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	HSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI
Expression Range	2-198aa
Protein Length	Full Length of Mature Protein
Mol. Weight	49.9kDa
Research Area	Apoptosis
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation.
Subcellular Location	Cytoplasm.
Protein Families	TNFAIP8 family
Database References	HGNC: 17260 OMIM: 612111 KEGG: hsa:25816 STRING: 9606.ENSP00000421848 UniGene: Hs.618488
Tissue Specificity	Expressed at high levels in the spleen, lymph node, thymus, thyroid, bone marrow and placenta. Expressed at high levels both in various tumor tissues, unstimulated and cytokine-activated cultured cells. Expressed at low levels in the spinal cord, ovary, l

Gene Functions References

TNFAIP8 regulates Hippo pathway through interacting with LATS1 to promote cell proliferation. PMID: 28926138
The indel chr5:118704153:D, located within TNFAIP8, showed an association with plantar fascial disorders at genome-wide significance (p<5x10(-8)) with small effects (odds ratios=0.93 and 1.07 per allele, respectively). PMID: 29534260
TNFAIP8 v2 may contribute to both carcinogenesis and chemotherapeutic resistance by broadly suppressing p53 activity, thus offsetting p53-dependent tumor suppression. PMID: 27834950
TNFAIP8 seems to regulate the cell survival and cancer progression processes in a multifaceted manner. (Review) PMID: 27807832
expression associated with cell survival and death in cancer cell lines infected with canine distemper virus PMID: 26373887
induction of TNFAIP8 is critical for the evasion of apoptosis by tumor cells expressing the K120R variant of p53. PMID: 27341992
Of these, three CpG sites on TNFAIP8 and PON1 genes (corresponding to: cg23917399; cg07086380; and cg07404485, respectively) were significantly differentially methylated between black and non-black individuals. The three CpG sites showed lower methylation status among infants of black women. PMID: 27000849
TNFAIP8 regulates Hippo (MST1/2) signaling through its interaction with LATS1. PMID: 28152516
TNFAIP8 overexpression is correlated with axillary lymph node metastasis and poor prognosis in invasive ductal breast carcinoma. PMID: 28087477
that MicroRNA-9-TNFAIP8 might represent a promising diagnostic biomarker for gastric cancer patients and could be a potential therapeutic target in the prevention and treatment of gastric cancer PMID: 28127811
these findings suggest that TNFAIP8 overexpression is a potential biomarker to identify pN0 esophageal squamous cell carcinoma patients at higher risk of lymphatic recurrence who may benefit from adjuvant therapy. PMID: 26886285
Expression of TNFAIP8 is up-regulated in human gastric cancer and regulates cell proliferation, invasion and migration. PMID: 25936980
Our data suggest that TNFAIP8 overexpression may contribute to lymph node metastasis and poor prognosis in intestinal-type gastric adenocarcinoma. PMID: 24621012
TNFAIP8 may be used as a prognostic marker for the recurrence of endometrial cancer (EC), and its promotion of the proliferation and metastasis in EC may be due to its mediation of Ki-67 and MMP9. PMID: 24590269
our findings indicate that TNFAIP8 overexpression is an independent predictor of platinum resistance in epithelial ovarian cancer PMID: 24767861
SCC-S2 may play roles in affecting both immune cells and tumor cells in the thyroid and may indicate a novel pathway for understanding the pathogenesis of the disease. PMID: 24464924
These results provide evidence that TNFAIP8 plays critical roles in non-small cell lung cancer PMID: 24136748
the TNFAIP8-rs11064 Single nucleotide polymorphism may function by affecting the affinity of miR-22 binding to the 3'-untranslated region of TNFAIP8 and regulating TNFAIP8 expression, thus contributing to cervical cancer risk PMID: 23299407
TNFAIP8 functions in oncogenesis are likely to involve activation of the integrin, MMP and VEGFR-2 signaling pathways. TNFAIP8 expression revealed correlation of both cytoplasmic and nuclear TNFAIP8 overexpression with high grade prostatic adenocarcinomas PMID: 23280553
SCC-S2 is overexpressed in colon cancers. PMID: 22886548
results showed stronger staining of TNFAIP8 protein in pancreatic cancer tissues compared with normal pancreas tissue; TNFAIP8 expression positively correlated with EGFR levels; results indicate TNFAIP8 may play important roles in the progression of pancreatic cancer PMID: 22631659
polymorphism of TNFAIP8 rs1045241C>T may contribute to NHL susceptibility in a Chinese population PMID: 22666399
Findings demonstrate that TNFAIP8 is one of critical components of a signal transduction pathway that links mesangial cell proliferation to diabetic renal injury. PMID: 20699119
SCC-S2 plays an important role in NSCLC and might be a useful therapeutic target of NSCLC. PMID: 20398053
SCC-S2 is a novel oncogenic factor in cancer cells PMID: 14724590
A chicken ovalbumin upstream promoter transcription factor I (COUP-TFI) complex represses expression of the gene encoding tumor necrosis factor alpha-induced protein 8 (TNFAIP8). PMID: 19112178

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.