Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 13B Protein (TNFSF13B) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-09972P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 13B Protein (TNFSF13B) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-09972P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 13B Protein (TNFSF13B) Protein (His-SUMO) is produced by our E.coli expression system. This is a extracellular protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q9Y275
Target Symbol TNFSF13B
Synonyms ApoL related ligand TALL 1; B cell Activating Factor; B lymphocyte stimulator; B-cell-activating factor; BAFF; BLyS; CD 257; CD257; CD257 antigen; Delta BAFF; Dendritic cell derived TNF like molecule; Dendritic cell-derived TNF-like molecule; DTL; DTL precursor; PRO738; soluble form; TALL 1; TALL-1; TALL1; THANK; TN13B_HUMAN; TNF and APOL related leukocyte expressed ligand 1; TNF homolog that activates apoptosis ; TNF homolog that activates apoptosis NKFB and JNK.; TNF- and APOL-related leukocyte expressed ligand 1; TNFSF13B; TNFSF20; TNLG7A; Tumor necrosis factor (ligand) superfamily member 13b; Tumor necrosis factor ligand 7A; Tumor necrosis factor ligand superfamily member 13b; Tumor necrosis factor ligand superfamily member 20; Tumor necrosis factor like protein ZTNF4; Tumor necrosis factor superfamily member 13B; UNQ401; ZTNF4
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His-SUMO
Target Protein Sequence QVAALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL
Expression Range 68-285aa
Protein Length Extracellular Domain
Mol. Weight 39.7kDa
Research Area Cancer
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Gene Functions References

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

More from Antibody / Cell Therapy Targets
Sale
Greater than 90% as determined by SDS-PAGE.
Recombinant Human T-Cell Surface Glycoprotein Cd3 Epsilon Chain (CD3E) Protein (His)
  • Molecule: CD3E;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: His;
  • Sequence: Extracellular Domain;
CAT#: BLC-11162P

Save $99
Sale
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Cd70 Antigen (CD70) Protein (His)
  • Molecule: CD70;
  • Species: Human;
  • Expression system: Yeast;
  • Tag: His;
  • Sequence: Extracellular Domain;
CAT#: BLC-10853P

Save $171
Sale
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL2.
Recombinant Human Interleukin-2 (IL2) Protein (GST)
  • Molecule: IL2;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: GST;
  • Sequence: Full Length Protein;
CAT#: BLC-10775P

Save $99
Sale
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Interleukin-31 (IL31) Protein (His&Myc)
  • Molecule: IL31;
  • Species: Human;
  • Expression system: Mammalian cell;
  • Tag: His&Myc;
  • Sequence: Full Length Protein;
CAT#: BLC-07658P

Save $810
Sale
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Interleukin-13 (IL13) Protein (His)
  • Molecule: IL13;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: His;
  • Sequence: Full Length Protein;
CAT#: BLC-07481P

Save $250
Sale
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Cytotoxic T-Lymphocyte Protein 4 (CTLA4) Protein (Twin-Strep)
  • Molecule: CTLA4;
  • Species: Human;
  • Expression system: Mammalian cell;
  • Tag: Twin-Strep;
  • Sequence: Protein Fragment;
CAT#: BLC-06724P

Save $871
Recently viewed