Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 18 (TNFSF18) Protein (hFc-Flag), Active
Beta LifeScience
SKU/CAT #: BLC-05840P

Greater than 90% as determined by SDS-PAGE.

Activity Measured by its binding ability in a functional ELISA. Immobilized TNFRSF18 at 2 μg/ml can bind TNFSF18 , the EC 50 is 2.565 to 2.940 ng/ml. Biological Activity Assay

Activity Human TNFRSF18 protein hFc tag captured on COOH chip can bind Human TNFSF18 protein hFc and Flag tag with an affinity constant of 38.5 nM as detected by LSPR Assay. Biological Activity Assay
Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 18 (TNFSF18) Protein (hFc-Flag), Active
Beta LifeScience
SKU/CAT #: BLC-05840P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 18 (TNFSF18) Protein (hFc-Flag), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | 1. Measured by its binding ability in a functional ELISA. Immobilized TNFRSF18 at 2 μg/ml can bind TNFSF18 , the EC 50 is 2.565 to 2.940 ng/ml. 2. Human TNFRSF18 protein hFc tag captured on COOH chip can bind Human TNFSF18 protein hFc and Flag tag with an affinity constant of 38.5 nM as detected by LSPR Assay. |
Uniprotkb | Q9UNG2 |
Target Symbol | TNFSF18 |
Synonyms | (AITRL)(hGITRL)(AITRL)(GITRL)(TL6) |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | N-hFc-Flag |
Target Protein Sequence | QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS |
Expression Range | 72-199aa |
Protein Length | Partial |
Mol. Weight | 42.8 |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Cytokine that binds to TNFRSF18/AITR/GITR. Regulates T-cell responses. Can function as costimulator and lower the threshold for T-cell activation and T-cell proliferation. Important for interactions between activated T-lymphocytes and endothelial cells. Mediates activation of NF-kappa-B. Triggers increased phosphorylation of STAT1 and up-regulates expression of VCAM1 and ICAM1. Promotes leukocyte adhesion to endothelial cells. Regulates migration of monocytes from the splenic reservoir to sites of inflammation. |
Subcellular Location | Cell membrane; Single-pass type II membrane protein. |
Protein Families | Tumor necrosis factor family |
Database References | |
Tissue Specificity | Expressed at high levels in the small intestine, ovary, testis, kidney and endothelial cells. |
Gene Functions References
- GITRL levels are significantly elevated in rheumatoid arthritis serum and synovial fluid and are positively correlated with autoantibody production in rheumatoid arthritis, suggesting a role of GITRL in the development of rheumatoid arthritis. PMID: 27098050
- GITRL modulates the activities of p38 MAPK and STAT3 to promote Th17 cell differentiation in autoimmune arthritis. PMID: 26657118
- An increase in GITRL may impair the balance of Th17/Treg, and contribute to the pathopoiesis of Hashimoto's thyroiditis. PMID: 25429429
- Serum GITRL levels were higher in SLE patients. PMID: 23251213
- Glucocorticoid-induced TNF-related ligand (GITRL) confers pseudoexpression to tumor cells by platelets, which results in GITRL expression by megakaryocytes and their platelet progeny. PMID: 22649191
- observation suggests a link between cytokine-regulated keratinocyte GITRL expression and its role in inflammatory responses in AD PMID: 22417213
- GITRL upregulation induced by IFN-beta on dendritic cells downregulates CTLA-4 on regulatory T (Treg) cells, facilitating proliferation of anergic Treg cells in multiple sclerosis treatment of multiple sclerosis patients. PMID: 22112394
- GITRL expression on Kupffer cells may mediate acute rejection in liver transplantation PMID: 21693309
- The incorporation of an isoleucine zipper motif could markedly improve the costimulation of hsGITRL. PMID: 20228835
- Upregulation by proinflammatory cytokines suggests GITRL may play important role in ocular immunity. High level of constitutive GITRL expression on photoreceptor inner segments suggests photoreceptors participate in regulation of ocular inflammation. PMID: 15326137
- Regulates ossteoclasst genersation and substantiate the major role played by the endothelium in bone physiology. PMID: 16179414
- Using a GITRL-transfected cell line, we demonstrate that GITRL promotes NK cell cytotoxicity and IFN-gamma production. PMID: 16397134
- GITRL could be a potential candidate for regulation of the ocular immune privilege and the balance between immune privilege and inflammation PMID: 16874737
- Constitutive expression of GITRL by tumor cells diminishes natural killer cell antitumor immunity. PMID: 17360848
- although huGITRL is not capable of alleviating Treg suppression of responder T cells, huGITRL overexpression on monocyte-derived DC enhances their capacity to induce antigen-specific T cell responses PMID: 17449724
- These observations raise the possibility that the GITRL-mediated inflammatory activation of macrophages is involved in the pathogenesis of inflammatory diseases. PMID: 17602748
- Levels of AITRL were significantly increased in serum of breast cancer patients PMID: 17914571
- hGITRL ectodomain displays considerable self-association/dissociation in solution with a dynamic equilibrium between trimeric and monomeric forms over the range of protein concentrations studied. PMID: 18040044
- identify multiple oligomeric species of hGITRL that possess distinct kinetics of ERK activation. PMID: 18378892
- The strong correlation of tumor incidence and elevated soluble GITRL levels indicates that soluble GITRL is released from cancers in vivo, leading to impaired NK cell immunosurveillance of tumors PMID: 18689545