Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 10C (TNFRSF10C) Protein (His-hFc), Active
Beta LifeScience
SKU/CAT #: BLC-06022P
Greater than 95% as determined by SDS-PAGE.
Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 10C (TNFRSF10C) Protein (His-hFc), Active
Beta LifeScience
SKU/CAT #: BLC-06022P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 10C (TNFRSF10C) Protein (His-hFc), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Activity | The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL is typically 450 ng/mL. |
Uniprotkb | O14798 |
Target Symbol | TNFRSF10C |
Synonyms | TNFRSF10C; DCR1; LIT; TRAILR3; TRID; UNQ321/PRO366; Tumor necrosis factor receptor superfamily member 10C; Antagonist decoy receptor for TRAIL/Apo-2L; Decoy TRAIL receptor without death domain; Decoy receptor 1; DcR1; Lymphocyte inhibitor of TRAIL; TNF-related apoptosis-inducing ligand receptor 3; TRAIL receptor 3; TRAIL-R3; TRAIL receptor without an intracellular domain; CD antigen CD263 |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | C-6His-hFc |
Complete Sequence | ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA |
Expression Range | 26-221aa |
Protein Length | Partial |
Mol. Weight | 48.7 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Target Details
Target Function | Receptor for the cytotoxic ligand TRAIL. Lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. May protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand. |
Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor. |
Database References | |
Tissue Specificity | Higher expression in normal tissues than in tumor cell lines. Highly expressed in peripheral blood lymphocytes, spleen, skeletal muscle, placenta, lung and heart. |
Gene Functions References
- High levels of TRAIL-R3 and CCR-2 expression in tumor epithelial cells identified patients with early breast cancer with poor outcomes. PMID: 28420351
- DcR1 levels in serum sample which were significantly lower in AMD patients. PMID: 24534820
- DcR1 upregulation mediates temozolomide resistance. PMID: 25808868
- GATA4 and DcR1 promoter hypermethylation is tumor specific event in glioblastoma but they promoter methylation cannot be considered as a prognostic marker of glioblastoma survival. PMID: 23320456
- Primary EOC is associated to a lower TRAIL-R3 expression. PMID: 22555108
- Data show that about 20% of AML patients highly expressed decoy receptor TRAIL-R3, which was strongly correlated to a shortened overall survival. PMID: 21281967
- Decoy receptors DcR1 and DcR2 on CD8+ T cells, but not on CD4-positive T cells, are positively correlated with patients' DAS scores. PMID: 20799941
- Results suggest that DcR1 expression occurs in a subset of endometrial carcinomas and may contribute to resistance to TRAIL-induced apoptosis. PMID: 19936781
- analysis of the transcription initiation sites and promoter structure of the TRAIL-R3 gene PMID: 12417331
- cloned and characterized a p53 consensus element located within the first intron of the TRAIL-R3 gene PMID: 14623878
- Our results demonstrate that DcR1 and DcR2 genes are frequently methylated in various tumor types, and aberrant methylation was the cause for silencing of DcR1 and DcR2 expression. PMID: 14999791
- The DcR1 had no death domain and was anchored to the membrane via a glycophosphatidyl inositol tail. PMID: 15538968
- Resistance to TRAIL-induced apoptosis in acute myeloid leukemia cells is associated with expression of TRAIL-R3. PMID: 15921376
- tryptophol induces apoptosis through DR5 and the resistance of PBL to tryptophol-induced apoptosis might be due to competition from DcR1 PMID: 17690453
- p53 negatively regulates oxaliplatin-mediated TRAIL-induced apoptotic activity through DcR1 upregulation. PMID: 18345033
- TRAILR3 (TNF-related apoptosis inducing ligand receptor 3) levels were significantly higher in lung parenchyma in subjects with emphysema PMID: 18511705
- Liver metastases with low DcR1/TNFRSF10C mRNA expression were more likely to present with extrahepatic metastases PMID: 18590575
- inactivation of TNFRSF10C by chromosomal deletion and promoter methylation may play an important role in prostate cancer development PMID: 19035483
- Low DCR1 is associated with non-small cell lung cancer. PMID: 19661294