Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 19L Protein (RELT) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08383P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 19L Protein (RELT) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08383P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 19L Protein (RELT) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q969Z4 |
Target Symbol | RELT |
Synonyms | Receptor expressed in lymphoid tissues; Relt; TNFRSF19L; TR19L_HUMAN; Tumor necrosis factor receptor superfamily member 19L |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRA |
Expression Range | 26-153aa |
Protein Length | Partial |
Mol. Weight | 17.7kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | May play a role in apoptosis. Induces activation of MAPK14/p38 and MAPK8/JNK MAPK cascades, when overexpressed. Involved in dental enamel formation. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. Cytoplasm. Cytoplasm, perinuclear region. |
Protein Families | RELT family |
Database References | |
Tissue Specificity | Spleen, lymph node, brain, breast and peripheral blood leukocytes (at protein level). Expressed highly in bone marrow and fetal liver. Very low levels in skeletal muscle, testis and colon. Not detected in kidney and pancreas. |
Gene Functions References
- Collectively, this study provides more insights into RELT expression, RELT family member function, and the mechanism of RELT-induced death. PMID: 28688764
- report that overexpression of RELT or its homologues RELL1 and RELL2 in HEK 293 epithelial cells results in cell death with morphological characteristics consistent with the activation of an apoptotic pathway. PMID: 19969290
- Receptor expressed in lymphoid tissue (RELT) and its novel homologues RELL1 and RELL2 co-localize with one another at the plasma membrane. PMID: 16389068