Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 1B Protein (TNFRSF1B), Active

Beta LifeScience SKU/CAT #: BLC-06037P

Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 1B Protein (TNFRSF1B), Active

Beta LifeScience SKU/CAT #: BLC-06037P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 1B Protein (TNFRSF1B), Active is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 97% as determined by SDS-PAGE and HPLC.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the TNF-α mediated cytotoxicity in the L-929 cells is less than 0.2 μg/ml, corresponding to a specific activity of >5000 IU/mg in the presence of 0.25 ng/mL of rHuTNF-α.
Uniprotkb P20333
Target Symbol TNFRSF1B
Synonyms CD120b; p75; p75 TNF receptor; p75TNFR; p80 TNF alpha receptor; p80 TNF-alpha receptor; Soluble TNFR1B variant 1; TBP-2; TBPII; TNF R II; TNF R2; TNF R75; TNF-R2; TNF-RII; TNFBR; TNFR-II; TNFR1B; TNFR2; TNFR80; TNFRII ; Tnfrsf1b; TNR1B_HUMAN; Tumor necrosis factor beta receptor; Tumor necrosis factor binding protein 2; Tumor necrosis factor receptor 2; Tumor necrosis factor receptor superfamily member 1B; Tumor necrosis factor receptor type II; Tumor necrosis factor-binding protein 2
Species Homo sapiens (Human)
Expression System E.Coli
Tag Tag-Free
Complete Sequence M+PAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPT
Expression Range 24-206aa
Protein Length Partial
Mol. Weight 20.0 kDa
Research Area Cancer
Form Liquid or Lyophilized powder
Buffer 0.2 μm filtered PBS, pH 7.4, lyophilized
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.

Target Details

Target Function Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.
Subcellular Location [Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.; [Tumor necrosis factor-binding protein 2]: Secreted.
Database References

Gene Functions References

  1. TL1A modulated Rheumatoid arthritis-fibroblast-like synoviocytes migration and Indian hedgehog signaling pathway using TNFR2. PMID: 29748156
  2. Data suggest that maternal glycemic response during pregnancy is associated with lower DNA methylation of 4 CpG sites within PDE4B gene in placenta (collected after normal-weight term birth); 3 additional CpG sites are differentially methylated relative to maternal glucose response within TNFRSF1B, LDLR, and BLM genes. (PDE4B = phosphodiesterase-4B; LDLR = low density lipoprotein receptor; BLM = Bloom syndrome protein) PMID: 29752424
  3. serum level did not change after tonsillectomy alone but decreased significantly after steroid pulse therapy in patients with IgA nephropathy PMID: 28389814
  4. Elevated serum TNFR2 may be a possible marker of COPD in asymptomatic smokers and ex-smokers. PMID: 28744116
  5. TNFR2 promoted Adriamycin resistance in breast cancer cells by regulating the DNA damage repair. PMID: 28677724
  6. Serum TNFR2 is a biomarker for patients with chronic kidney disease. PMID: 28667032
  7. Data indicate activators of tumor necrosis factor receptor 2 (TNFR2) and a potential role for this target in immunotherapy. PMID: 27626702
  8. In this study, we identified a novel association between ANCA levels, TNFRSF1B genotype and decreased circulating TNFR2 levels, which may be reflective of the underlying biological mechanisms that determine clinical expression and/or response to certain therapies. PMID: 27104820
  9. In Han Chinese population of Hunan province, TNFRSF1B+676 gene polymorphisms are not associated with the genetic risk of rheumatoid arthritis PMID: 27640805
  10. Results showed that TNFR2 was upregulated in papillary thyroid carcinoma tissues, and its expression is regulated by H19. PMID: 29287713
  11. The TNFRSF1Brs3397 variant may play a role in modulating the risk of rheumatoid arthritis, but does not provide strong evidence of an impact of TNFRSF1B variants in determining response to anti-TNF drugs. PMID: 25850964
  12. atopic dermatits patients had increased TNFR2 expression on immune cells PMID: 29212072
  13. the blocking of tumor necrosis factor receptor 2 (TNFR2) decreased TL1A-stimulated IL-6 production by rheumatoid arthritis fibroblast-like synoviocytes. PMID: 27081759
  14. Data suggest that, by targeting tumor cells and immunosuppressive tumor-associated Tregs, antagonistic tumor necrosis factor receptor 2 (TNFR2) antibodies may be an effective treatment for cancers positive for TNFR2. PMID: 28096513
  15. p75 neurotrophin receptor (p75TNFR) was the first NGFR (nerve growth factor receptor) to be cloned and the founding member of the TNFR (tumor necrosis factor receptor) superfamily. However, data suggest that p75TNF is an atypical TNFR superfamily protein; p75TNFR forms dimers (activated by dimeric neurotrophins) that are structurally unrelated to TNFR superfamily proteins. [REVIEW] PMID: 28215307
  16. High plasma levels of TNFR2 and TNFR1 were associated with incident intracerebral hemorrhage. PMID: 28830973
  17. Serum TNFR2 levels were elevated in lupus nephritis patients versus controls. PMID: 27973968
  18. Voxel-based morphometry was used to analyse the associations between TNFRSF1B (rs1061624) genotypes and grey matter structure. Analysis of the TNFRSF1B SNP rs1061624 yielded a significant association with hippocampal but not with striatal volume, whereby G homozygotes were associated with increased volumes relative to A homozygotes and heterozygotes. PMID: 27528091
  19. Our results demonstrated that Treg frequencies and TNFR2 expression on Tregs are increased in sarcoidosis, followed by a decline during infliximab therapy, suggesting a pathophysiological role of this T cell subset. PMID: 27158798
  20. identified 6 known and 4 novel variations in 6 different exons of TNFR2 gene; out of these identified variations, 5 known variations were found to be significantly associated with the risk of cervical cancer; postmenopausal women having CAAGC + CTGCC haplotypes in TNFR2 gene along with HPV infection and tobacco consumption may lead to the development of cervical cancer PMID: 27145290
  21. LTbetaR is essential for efficient liver regeneration and cooperates with TNFRp55 in this process. Differences in survival kinetics strongly suggest distinct functions for these two cytokine receptors in liver regeneration. PMID: 26708145
  22. that U87-p75(NTR) cells express higher levels of Cdh-11 protein and that siRNA-mediated knockdown of Cdh-11 resulted in a significant decrease in p75(NTR)-mediated glioblastoma cell migration PMID: 26476273
  23. TNF-alpha/TNFR2 regulatory axis stimulates EphB2-mediated neuroregeneration via activation of NF-kappaB. PMID: 26492598
  24. This meta-analysis demonstrates that TNFRSF1B T allele carriers show a better response to anti-TNF therapy--{REVIEW} PMID: 26071216
  25. Pretransplant recipient circulating CD4+CD127lo/-TNFR2+ Treg cell is potentially a simpler alternative to Treg cell function as a pretransplant recipient immune marker for acute kidney injury. PMID: 26425877
  26. NGF has a role in modulating trkANGFR/p75NTR in alphaSMA-expressing conjunctival fibroblasts from human ocular cicatricial pemphigoid PMID: 26569118
  27. our findings implicate TNFR2 in supporting myeloid-derived suppressor cells -mediated immune suppression and metastasis in the liver PMID: 26483205
  28. In conclusion, we report a significant association between the TNFRSF1B p.M196R variant and the risk for psoriasis and the response to treatment with anti-TNF or anti-Il-12/Il-23. PMID: 25537528
  29. Plasma sTNFR2 was higher during pregnancy compared with controls. Urinary levels of sTNFR2 were higher in preeclampsia and pregnant women compared with controls. PMID: 25034210
  30. study suggests that TNFR2(+) Tregs play a role in promoting tumor progressive metastasis PMID: 26280204
  31. Recurrent point mutations and genomic gains of TNFRSF1B, encoding the tumor necrosis factor receptor TNFR2, are present in a subset of patients with mycosis fungoides and Sezary syndrome. PMID: 26258847
  32. Increased plasma level of sTNFRII is found to be associated with exudative age-related macular degeneration. PMID: 25363549
  33. ADAM17 was identified as the protease responsible for TNFR2 shedding by CD8(+) T cells, with ADAM17 and TNFR2 required in "cis" for shedding to occur. PMID: 26019295
  34. hTNFR2 blocks the biological activity of lymphotoxin beta. PMID: 25940088
  35. NRH2 enhanced the ratio of Bax/Bcl-2 by promoting the expressions of proNGF, sortilin and p75NTR, thereby inducing brain cell apoptosis. PMID: 25854576
  36. Only TNFR2 can induce TRAF2 degradation. PMID: 25152365
  37. Data show that TNF-alpha receptor TNFR2 mRNA expression was significantly increased after 6, 9 and 12 hours of poly (I:C) stimulation. PMID: 25419735
  38. Functional TNFR2 196 M/R polymorphism is associated with susceptibility to rheumatoid arthritis in the European population. PMID: 24777778
  39. Serum TNFR2 is associated with renal decline and ESRD risk in type 1 diabetes and proteinuria. PMID: 24898299
  40. The TNFRII nt587 G/G genotype may increase the risk of developing AS in the Chinese population. PMID: 25061744
  41. High TNF receptor 2 is closely associated with the loss of kidney function. PMID: 24717758
  42. Inflammation mediated through TNFalpha and its receptors, TNFR1 and TNFR2, may represent an important component of a comorbidity-induced inflammatory response that partially drives the pathophysiology of heart failure (HF) with preserved ejection fraction. PMID: 24923671
  43. TNF-TNFR2 signaling may induce RBR in naive BM-EPCs and that blocking TNF-TNFR2 signaling may prevent delayed RBR in BM-EPCs, conceivably, in bone marrow milieu in general PMID: 24711449
  44. Blood levels of CRP, IL-6 and TNFalpha-R2 are not associated with incident depression. PMID: 24836084
  45. Addition of leukemia inhibitory factor (LIF) neutralizing antibodies inhibited oligodendrocyte differentiation, indicating a crucial role of TNFR2-induced astrocyte derived LIF for oligodendrocyte maturation PMID: 24310780
  46. Higher plasma TNFR75 levels were associated with decreased time to first COPD exacerbatino in a prospective study. PMID: 24136332
  47. Our results support a role of TNFRSF1B gene variants in the response to IFX in CD patients. PMID: 24121042
  48. Serum TNFR2 expression levels might be a powerful prognostic factor for patients treated with the R-CHOP regimen. PMID: 23672298
  49. Release of nonmuscle myosin II from the cytosolic domain of tumor necrosis factor receptor 2 is required for target gene expression. PMID: 23861542
  50. genetic association studies in a population of women in Tunisia: Data suggest that an SNP in exon 6 of TNFR2/TNFRSF1B (rs1061622) is associated with pre-eclampsia. PMID: 23799986

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed