Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 4 (TNFRSF4) Protein (hFc), Active

Name: Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 4 (TNFRSF4) Protein (hFc), Active
Brand: Beta LifeScience
SKU: BLC-05623P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Cluster of differentiation (cd) proteins, Cytokines, Cytokines and growth factors, Featured cd protein molecules, Featured immune checkpoint protein molecules, Immune checkpoint proteins, Recombinant proteins, Tumor necrosis factors and receptors (tnfs)

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 4 (TNFRSF4) Protein (hFc), Active is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined by its ability to bind Human TNFSF4 in functional ELISA is less than 10 ug/ml.
Uniprotkb	P43489
Target Symbol	TNFRSF4
Synonyms	TNFRSF4; TXGP1L; Tumor necrosis factor receptor superfamily member 4; ACT35 antigen; OX40L receptor; TAX transcriptionally-activated glycoprotein 1 receptor; CD antigen CD134
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-hFc
Complete Sequence	LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA
Expression Range	29-216aa
Protein Length	Partial
Mol. Weight	46.8 kDa
Research Area	Cancer
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity.; (Microbial infection) Acts as a receptor for human herpesvirus 6B/HHV-6B.
Subcellular Location	Membrane; Single-pass type I membrane protein.
Database References	HGNC: 11918 OMIM: 600315 KEGG: hsa:7293 STRING: 9606.ENSP00000368538 UniGene: Hs.129780
Associated Diseases	Immunodeficiency 16 (IMD16)

Gene Functions References

High OX40 expression in Ovarian carcinoma is correlated with chemosensitivity and improved recurrence free survival in Ovarian carcinoma . Patients might therefore benefit from a second line therapy. PMID: 29661166
Increased OX40 expression is associated with gastric cancer. PMID: 29529339
this study demonstrates that cSCCs contain an abundance of Tregs which can suppress tumoral effector T cell function and that activation of the costimulatory receptor OX40 enhances tumoral T cell responses. PMID: 27034329
OX40 expression on T cells was positively associated with obesity in humans. PMID: 28612217
Metabolically active CD4+ T cells expressing Glut1 and OX40 preferentially harbor HIV during in vitro infection. PMID: 28892135
this study investigated whether CD134 is preferentially expressed on CD4 T cells in drug-induced hypersensitivity syndrome . PMID: 27174092
blocking of both OX-40L and 4-1BBL reversed radiation-enhanced T-cell killing of human tumor targets as well as T-cell survival and activation. PMID: 26872462
Low OX40 expression is associated with colorectal cancer. PMID: 26439988
OX40 and its ligand are co stimulators for T lymphocytes. PMID: 26755473
These studies provide the first direct evidence that ligation of tumour necrosis factor superfamily members and their cognate receptors is important for the control of viral lytic replication. PMID: 26467721
Malaria patients and Plasmodium-infected rodents exhibit enhanced expression of the co-stimulatory receptor OX40 on CD4 T cells, which is abrogated following coordinate PD-1 co-inhibitory pathways, which are also upregulated during malaria. PMID: 25891357
Identified two key amino acid residues within CD134 that are required for its interaction with herpesvirus 6B (HHV-6B) and for HHV-6B entry into cells. One of the residues (K79) allows access of the HHV-6B ligand to CD134. PMID: 26202244
TL1A increases expression of CD25, LFA-1, CD134 and CD154, and induces IL-22 and GM-CSF production from effector CD4 T-cells PMID: 25148371
High expression of OX40 is associated with type 1 diabetes. PMID: 24797972
A cysteine-rich domain of CD134 that is critical for binding to the HHV-6B glycoprotein gH/gL/gQ1/gQ2 complex and HHV-6B infection. PMID: 25008928
cirrhotic and hepatocellular carcinoma fragments moderately and highly infiltrated by Tregs, respectively, expressing OX40 PMID: 24756990
data show that Ag-specific CD4(+) CD25(+) CD134(+) CD39(+) T cells are highly enriched for Treg cells, form a large component of recall responses and maintain a Treg-cell-like phenotype upon in vitro expansion. PMID: 24752698
expression is associated with breast cancer in a stage dependent manner PMID: 23502335
OX40 signals regulate CD8 T cell survival at least in part through maintaining expression of the anti-apoptotic molecule A1 PMID: 23936461
Hyperactivation of the Akt pathway in Teff cells from children with lupus nephritis is associated with reduced induction of TRAF6 and up-regulation of OX40, which may cause Teff cell resistance to Treg cell-mediated suppression. PMID: 23896866
This study identified OX40 as a key molecule and biomarker for rapid progression of HTLV-1-associated myelopathy/tropical spastic paraparesis. PMID: 23651542
CD134 is a cellular receptor specific for human herpesvirus-6B entry. PMID: 23674671
Head and neck cancer patients have decreased levels of alternative co-stimulatory receptors OX40 and 4-1BB. PMID: 22204816
CD137 activity is directly proportional to colorectal cancer stage. Surgical resection of the tumor results in increased CD134 and CD137 expression PMID: 22343199
We show that the inflammatory and cytotoxic function of CD4(+)CD28(null) T cells can be inhibited by blocking OX40 and 4-1BB costimulatory receptors. PMID: 22282196
PAPP-A level was significantly related to soluble and membrane-bound OX40L in patients with ACS. PMID: 21111564
Compared with control group, the expression of OX40 and Bcl-2 was significantly higher in allergic rhinitis. PMID: 19253527
Transgenic OX40 forms a signaling complex in T cells that contains phosphoinositide 3-kinase (PI3K) and protein kinase B (PKB). PMID: 21289304
High OX40 expression may be associated with malignant transformation, progression, invasion and metastasis in breast cancer biology. PMID: 20634005
Possible proinflammatory effects of OX40L on the pathogenesis of atherosclerois. PMID: 21086790
This study has shown that activation of OX40 induces CCL20 expression in the presence of antigen stimulation. PMID: 20400327
The rs2298212G/A polymorphism in OX40 gene may be associated with the severity of coronary atherosclerotic disease. PMID: 20376799
Data suggest the role of Perforin + cytotoxic T lymphocytes and CD134+ cells in the pathogenesis of autoimmunity of SLE. PMID: 20306696
Pimecrolimus inhibits up-regulation of OX40 and synthesis of inflammatory cytokines upon secondary T cell activation by allogeneic dendritic cells. PMID: 12296857
CD134 positive cells are identified within inflammatory lesions of active multiple sclerosis (MS), acute MS and chronic active MS as well as in acute disseminated leukoencephalitis patients. PMID: 14644025
Mutagenesis showed that Asp60 and Asp62 are required for interaction with FIV, and modeling studies localized these two residues to the outer edge of domain 1 PMID: 15592478
The expression of CD134 was markedly higher, compared to CD137, both on the day of the surgery and ten days after colorectal cancer surgery. PMID: 15638367
Deficiencies in OX40 and CD30 signals were additive, secondary Ab responses were ablated.OX40/CD30 double-knockout OTII transgenic T cells fail to survive compared with normal T cells when cocultured with CD4(+)CD3(-) cells in vitro. PMID: 15778343
Decrease in OX40 expression posttransplant includes the defective reconstitution of Treg cells, and the active inhibition of gene transcription by cyclosporine. PMID: 15808546
stimulation of OX40/4-1BB rendered cells sensitive to apoptosis induced by TNF-alpha and reduced activation of NF-kappaB. OX40/4-1BB stimulation repressed the mitogen response in activated CD25+CD4+ T cells and preactivated CD8+ T cells PMID: 15941918
CD3+ T lymphocytes co-expressing CD134 and CD137 antigens on peripheral blood revealed an increased percentages of OX-40/CD137 positive cells in patients with Graves' disease (p<0.025) compared to the controls. PMID: 16232366
The relevance of these findings is supported by the vital functions fulfilled by OX40 in mammals as reflected by the high level of evolutionary conservation. PMID: 16329997
The coexpression of CD25 and the costimulatory molecule CD134 on memory T-cells provides a novel marker for type 1 diabetes-associated T-cell immunity. PMID: 16380476
OX40 ligation on CD4(+) T cells represents a potentially novel immunotherapeutic strategy that should be investigated to treat and prevent persistent virus infections, such as HIV-1 infection. PMID: 16456009
OX40 is induced transiently on CD8(+) T cells upon activation and its signals contribute to both clonal expansion and functional reinforcement PMID: 16750861
In the present study we found that costimulation via OX40 and TNF-R in OX40-expressing HIV-1-infected T cell lines leads to a marked reduction of HIV-1 production associated with rapid cell death. PMID: 18327975
The expression of OX40 on CD4+ T cells in sentinel lymph nodes draining primary melanomas decreased withe more advanced tumor features, suggesting an immunosuppressive effect. PMID: 18374895
Activity of OX40 ligand is enhanced by oligomerization and cell surface immobilization. PMID: 18397322
the frequency of the most frequent haplotype, C-C-A-A, was significantly lower and that of the second most frequent, C-T-G-A, was significantly higher in hypertensive subjects than in controls. This difference was observed only in female patients PMID: 18398332
These data offer a novel approach for UCB Treg expansion using aAPCs, including those coexpressing OX40L or 4-1BBL. PMID: 18645038

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.