Recombinant Human TWEAK Protein (Animal Free)
Beta LifeScience
SKU/CAT #: BLA-9323P
Recombinant Human TWEAK Protein (Animal Free)
Beta LifeScience
SKU/CAT #: BLA-9323P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | O43508 |
Synonym | APO 3 ligand APO 3L APO3 ligand APO3/DR3 ligand APO3L DR3LG MGC129581 MGC20669 secreted form TNF-related weak inducer of apoptosis TNF12_HUMAN TNFSF 12 Tnfsf12 TNFSF12 protein Tumor necrosis factor (ligand) superfamily member 12 Tumor necrosis factor ligand superfamily member 12 Tumor necrosis factor superfamily member 12 TWEAK UNQ181/PRO207 |
Description | Recombinant Human TWEAK Protein (Animal Free) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MKGRKTRARR AIAAHYEVHP RPGQDGAQAG VDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAV YLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLR IRTLPWAHLKAAPFLTYFGLFQVH |
Molecular Weight | 17 kDa |
Purity | >98% SDS-PAGE.assessed also by HPLC |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Assay #1: The ED50 as determined by the dose-dependent stimulation of IL-8 production by human PBMC is less than 10 ng/ml. Assay #2: TWEAK weakly induces the death of HT29 cells when cultured in the presence of IFN-. The ED50 for this effect is between 30-45 ng/ml. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Binds to FN14 and possibly also to TNRFSF12/APO3. Weak inducer of apoptosis in some cell types. Mediates NF-kappa-B activation. Promotes angiogenesis and the proliferation of endothelial cells. Also involved in induction of inflammatory cytokines. Promotes IL8 secretion. |
Subcellular Location | Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor ligand superfamily member 12, secreted form]: Secreted.; [Isoform TWE-PRIL]: Cell membrane; Single-pass membrane protein. |
Protein Families | Tumor necrosis factor family |
Database References | |
Tissue Specificity | Highly expressed in adult heart, pancreas, skeletal muscle, brain, colon, small intestine, lung, ovary, prostate, spleen, lymph node, appendix and peripheral blood lymphocytes. Low expression in kidney, testis, liver, placenta, thymus and bone marrow. Als |
Gene Functions References
- Observational study of gene-disease association. (HuGE Navigator) PMID: 19913121
- Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) PMID: 20628086