Recombinant Human Uteroglobin Protein
Beta LifeScience
SKU/CAT #: BLA-1176P
Recombinant Human Uteroglobin Protein
Beta LifeScience
SKU/CAT #: BLA-1176P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P11684 |
Synonym | Blastokinin CC10 CC16 CCPBP CCSP Clara cell phospholipid binding protein Clara cell phospholipid-binding protein Clara cell specific 10 kD protein Clara cells 10 kDa secretory protein OTTHUMP00000236107 SCGB1A1 Secretoglobin family 1A member 1 Secretoglobin, family 1A, member 1 (uteroglobin) UG UGB UP-1 UP1 Urinary protein 1 Urine protein 1 UTER_HUMAN Uteroglobin |
Description | Recombinant Human Uteroglobin Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | EICPSFQRVIETLLMDTPSSYEAAMELFSPDQDMREAGAQLKKLVDTLPQ KPRESIIKLMEKIAQSSLCN |
Molecular Weight | 16 kDa |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Fully biologically active when compared to standard. The ED50 as determined by the ability of the immobilized protein to support the adhesion of the A549 human lung carcinoma cells is less than 5.0 μg/ml, corresponding to a specific activity of >200 IU/m. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Binds phosphatidylcholine, phosphatidylinositol, polychlorinated biphenyls (PCB) and weakly progesterone, potent inhibitor of phospholipase A2. |
Subcellular Location | Secreted. |
Protein Families | Secretoglobin family |
Database References | |
Tissue Specificity | Clara cells (nonciliated cells of the surface epithelium of the pulmonary airways). |
Gene Functions References
- There was no evidence that serum CC16 levels played a role in recurrent wheezing and a positive asthma predictive index in pre-school children PMID: 29685782
- Data suggest that the increase in plasma club cell protein (CC16) CC16 following inhaled allergen as a biomarker of epithelial dysfunction. PMID: 28862880
- We propose that increased CC-16 levels is a marker of lung inflammatory response that associated with ventilatory insufficiency are related to impending respiratory failure, not fully predicted by conventional respiratory tests PMID: 28967121
- Studied serum CC16 levels in The serum CC16 levels in Acute respiratory distress syndrome (ARDS) and non-ARDS patients; found CC16 to be were significantly higher in ARDS patients than that in non-ARDS patients. PMID: 28548310
- Studied serum CC16 levels in relation to atopy and previously manifested low respiratory tract diseases. Found low serum CC16 is associated with previously expressed pneumonia and chronic wheezing in atopic children. PMID: 28146340
- Our data suggest that rCC16 suppresses LPS-mediated inflammatory mediator TNF-alpha, IL-6, and IL-8 production by inactivating NF-kappaB and p38 MAPK but not AP-1 in RAW264.7 cells. PMID: 28338974
- There were associations between urinary CC16 and arsenic concentration in soil, water, house dust, and dust loading. In multiple analyses, only the concentration of arsenic in soil was associated with urinary CC16 levels after accounting for other factors. PMID: 27223295
- findings demonstrate that CC16 is upregulated in IPF patients suggesting that may participate in its pathogenesis. PMID: 27977812
- The G38A CCSP gene polymorphism may alter either the production of the protein and/or its activity in chronic obstructive pulmonary disease. PMID: 27496897
- CC16 levels differed among idiopathic pulmonary fibrosis, pulmonary sarcoidosis and chronic pulmonary obstructive disease. PMID: 27758987
- Lung-specific (CC-16) and novel (RelB) biomarkers are associated with systemic cardiovascular changes over time. CC-16 can predict subsequent exacerbations in subjects with severe COPD and may be an important biomarker of pulmonary and systemic stress in COPD. PMID: 26914709
- The serum concentration of CC16 was significantly higher in patients with lung fibrosis. PMID: 25244495
- lower levels of urine CC16 and lung function in patients with asthma than in those patients without asthma. CC16 in urine may be a useful tool or biomarker for investigating lung epithelium integrity among children with asthma or lung injury. PMID: 26108072
- Smokers and COPD patients had reduced airway CC16 immunostaining that decreased with increasing COPD severity. PMID: 25700379
- the uteroglobin G38A gene polymorphism was not associated with IgAN risk PMID: 25068828
- Sputum and bronchoalveolar lavage fluid CC16 were significantly higher in patients with severe asthma compared to mild-moderate asthma and healthy controls. PMID: 25728058
- In chromium-exposed workers, blood levels of CC16, and CC16/SP-D were lower than in controls. Positive relationships were shown between CC16 or CC16/SP-D and indicators of lung function. PMID: 25851191
- KL-6 levels were higher and CC16 levels were lower in infants with poor neurodevelopmental outcome compared with those infants who had favourable neurodevelopmental outcome. PMID: 25631862
- CC16 may play an important protective role in cigarette smoke-related diseases. PMID: 25635997
- A meta-analysis indicated that the CC16 gene A38G polymorphism is not associated with the risk of asthma. PMID: 25743006
- Increased plasma clara cell secretory protein levels are associated with primary graft dysfunction. PMID: 24400993
- Uteroglobin is a possible ligand of the lipoxin receptor and it may have a role in inhibiting serum amyloid A-driven inflammation PMID: 24782597
- Athletes with decreased serum CC16 from regular high-load exercise are more susceptible to respiratory infections. PMID: 24735334
- A single therapeutic dose of terbutaline offers significant protection against hyperpnoea-induced bronchoconstriction and reduces urinary CC16 protein levels. PMID: 24030662
- Lung permeability biomakers [surfactant protein D (SP-D) and Clara cell secretory protein (CC16) in plasma] and forced expiratory volumes and flow were measured in swimmers in indoor swimming pool waters treated with different disinfection methods. PMID: 23874631
- Serum CC-16 is associated with disease progression in chronic obstructive pulmonary disease (COPD). However, the absence of CC-16 does not appear to modify the risk of cigarette-related COPD in mice. PMID: 24245748
- Acute exposure to smoke induces injury at the alveolar level, which results in a transient increase of CC16 in serum of exposed subjects. PMID: 23258467
- These results suggest that the CC16 A38G polymorphism may play a role in asymptomatic airway hyper-responsiveness and contribute to the development of late-onset asthma. PMID: 24125144
- The SCGB1A1 +38A/G polymorphism is a risk factor for asthma. [Meta-analysis] PMID: 23820082
- urinary CC16 may be a useful biomarker of increased lung epithelial permeability among female non-smokers; further work will be required to evaluate its applicability to males PMID: 22805990
- Clara cell secretory protein expression changes is a relevant marker in the development of bronchiolitis obliterans patients with lung transplantation. PMID: 22883104
- Overview of CC16 in pathophysiology of and as a biomarker in chronic obstructive pulmonary disease. PMID: 23030587
- A Genome wide association study for COPD biomarkers on subjects with COPD found 2 discrete loci affecting CC16, one near the CC16 coding gene (SCGB1A1) on chromosome 11 and one approximately 25Mb away from SCGB1A1, identified in expressed sputum. PMID: 23144326
- Donor CCSP A38G polymorphism is associated with decreased CCSP levels early after lung transplantation and poor long-term outcomes. PMID: 22902791
- Exercise caused an increase in urinary excretion of CC16 in all subjects (P < 0.001), but this rise in CC16 was blunted following inhalation of warm humid air. PMID: 21799131
- demonstration that cc-10 is differentially expressed in infants with iRDS may point the way towards one possible mechanism that potentially involves modifications of the protein structure with its anti-inflammatory and surfactant protective function PMID: 22613976
- CC10 G+38A variant may contribute to the severity of asthma and lower level of steroid responsiveness. PMID: 22788242
- These results indicate that CC10 gene transfer may inhibit airway inflammation through suppressing the activation of NF-kappaB. PMID: 22558282
- Serum Clara cell secretory protein levels were characterized by an early postnatal surge. This apparent gestation-influenced surge may represent an initiation of a protective cascade against postnatal lung injury during extrauterine adaptation. PMID: 21952535
- Single-nucleotide polymorphism in the CC10 gene (A38G) does not seem to be involved in the severity of respiratory syncytial virus infection or wheezing. PMID: 21767304
- Urinary levels of CC16 are increased after eucapnic voluntary hyperpnea. PMID: 21131866
- Elevated circulating CC16 levels identified severe thoracic injury combined with a strong correlation with the extent/volume of affected lung tissue. PMID: 21045740
- CC16 38A/38A genotype plays a role in the development of early asthma in children with AR. PMID: 21255142
- Elevated plasma clara cell secretory protein concentration is associated with high-grade primary graft dysfunction. PMID: 21299834
- In the context of allergic airway responses, CC10 can inhibit OPN expression and suppress the Th2-promoting function of OPN, resulting in CC10's inhibitory biological effects. PMID: 20553297
- Data suggest that a supernatant of non-small-cell lung cancer causes an imbalance in the immune response of PBMCs and DCs, which is reversed by CC-10. PMID: 20664959
- Letter: serum CCSP cannot be used as a biomarker predictive for bronchiolitis obliterans after lung transplantation. PMID: 20683434
- Reduced anti-inflammatory CC10 concentrations in airways of extremely premature infants with a fetal inflammatory response, not umbilical cord serum CC10, might make their lungs susceptible for further postnatal injuries. PMID: 19887851
- Association of CC16 with daily outdoor particulate matter from combustion sources increases epithelial barrier permeability in lungs. PMID: 19852548
- The effect of G38A may be apparent under stimulation as sex steroids or infections, and homozygotes of the G38A mutation cannot produce sufficient UG in response to stimulation and may be predisposed to IgA nephropathy, especially in childhood. PMID: 11774099