Recombinant Human Vascular Endothelial Growth Factor B (VEGFB)
Beta LifeScience
SKU/CAT #: BLC-00464P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Vascular Endothelial Growth Factor B (VEGFB)
Beta LifeScience
SKU/CAT #: BLC-00464P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Vascular Endothelial Growth Factor B (VEGFB) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P49765 |
Target Symbol | VEGFB |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | Tag-Free |
Target Protein Sequence | HQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKK |
Expression Range | 31-129aa |
Protein Length | Partial |
Mol. Weight | 11.3 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Growth factor for endothelial cells. VEGF-B167 binds heparin and neuropilin-1 whereas the binding to neuropilin-1 of VEGF-B186 is regulated by proteolysis. |
Subcellular Location | Secreted. Note=Secreted but remains associated to cells or to the extracellular matrix unless released by heparin. |
Protein Families | PDGF/VEGF growth factor family |
Database References | |
Tissue Specificity | Expressed in all tissues except liver. Highest levels found in heart, skeletal muscle and pancreas. |
Gene Functions References
- High plasma VEGF-B levels are associated with type 2 diabetes mellitus. PMID: 28523459
- Data from clinical studies point out the changes in circulating or tissue expression levels of VEGF-B in obese compared with lean patients. PMID: 28798193
- Cardiac transgenic vascular endothelial growth factor-B overexpression failed to protect heart transplants from ischemia-reperfusion injury. PMID: 27588416
- renal VEGF-B expression correlates with the severity of Diabetic Kidney Disease. PMID: 28190774
- Data show that metformin treatment reduces serum vascular endothelial growth factor B (VEGF-B) levels and ameliorates insulin resistance. PMID: 26387747
- Frameshift mutations of VEGFB gene is associated with stomach and colorectal cancers. PMID: 25633991
- fluid shear stress induces the synthesis of Insulin growth factor-2 and vascular endothelial growth factor (VEGF) B and D, which in turn transactivate MMP-12. PMID: 25435370
- MMP9 may activate VEGF-B via PI3K/Akt signaling pathway. PMID: 25424698
- Roles of vascular endothelial growth factor in amyotrophic lateral sclerosis. PMID: 24987705
- Low VEGFB and VEGFD gene expression is associated with early-stage non-small cell lung cancer. PMID: 24145997
- Our study suggested that VEGF-B was an angiogenesis factor in vitro and that ERK1/2 and p38-related signaling pathways were involved in these VEGF-B activities. PMID: 24374930
- VEGF-B has possible roles in cardiac protection, energy metabolism support, and neuroprotectin [review] PMID: 24987005
- High VEGF-B levels might correlate with the presence of hyperlipidemia and target organ damage in type 2 diabetic patients. PMID: 25001655
- High VEGFB expression is associated with bone marrow metastasis in neuroblastoma. PMID: 23553333
- VEGF-B might be an important ligand in the signalling between the tumor and preexisting blood vessels to ensure a functional blood supply for tumor survival. PMID: 23417498
- we report significant associations with overall survival and distant failure for certain VEGF(VEGF-B) family members. PMID: 23728940
- Data indicate that three miRs (miR-484, -642, and -217) were able to predict chemoresistance and vasculature of serous epithelial ovarian carcinomas through the regulation of the VEGFB and VEGFR2 pathways. PMID: 23697367
- Expression of VEGF-B genes in glioma cell lines U87 is significantly changed under hypoxia and ischemic conditions. PMID: 23350126
- In WT1 mutant cells, reduced VEGF(165)b was due to lack of WT1-mediated transcriptional repression of the splicing-factor kinase SRPK1 PMID: 22172722
- analysis of binding of vascular endothelial growth factor-B by VEGFR-1(D2) PMID: 20501651
- TIMP3 blocks the binding of VEGF to VEGF receptor-2 and inhibits downstream signaling and angiogenesis. PMID: 12652295
- Results describe the crystal structure of human vascular endothelial growth factor-B (VEGF-B) and present a predicted model for the association of VEGF-B with the second domain of its receptor, VEGFR-1. PMID: 16616187
- Basophils could play a role in angiogenesis and inflammation through the expression of several forms of VEGF-B and their receptors. PMID: 17082651
- VEGFB, and receptor were highly expressed in dysplastic neurons. IR in astroglial and balloon cells was observed for VEGFA and its receptors Double-labeling also showed expression of VEGFA, VEGFB and VEGFR-1 in cells of the microglia/macrophage lineage. PMID: 18317782
- VEGF-B appears to have a relatively restricted angiogenic activity in the ischemic heart. PMID: 18511699
- Increased VEGFB expression is associated with hepatocellular carcinoma PMID: 18537151
- Overexpression of vascular endothelial growth factor-B in mouse heart alters cardiac lipid metabolism and induces myocardial hypertrophy. PMID: 18757827
- The structural features of the 'highly ordered' interaction of the Fab fragment of the antibody (Fab-2H10) with VEGF-B, is presented. PMID: 18930733
- VEGF-B mRNA was not expressed either in normal urothelium or in bladder cancer. PMID: 19424629