Recombinant Human VEGFA Protein
Beta LifeScience
SKU/CAT #: BLA-2407P
Recombinant Human VEGFA Protein
Beta LifeScience
SKU/CAT #: BLA-2407P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P15692-4 |
Synonym | Folliculostellate cell-derived growth factor Glioma-derived endothelial cell mitogen MGC70609 MVCD1 vascular endothelial growth factor Vascular endothelial growth factor A vascular endothelial growth factor A121 vascular endothelial growth factor A165 Vascular permeability factor Vegf VEGF A VEGF-A VEGF120 Vegfa VEGFA_HUMAN VPF |
Description | Recombinant Human VEGFA Protein was expressed in Mammalian. It is a Full length protein |
Source | Mammalian |
AA Sequence | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQ LELNERTCRCDKPRR |
Molecular Weight | 19 kDa |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at room temperature. Store at -20°C. |