Recombinant Human Versican Core Protein (VCAN) Protein (His-B2M&Myc)

Name: Recombinant Human Versican Core Protein (VCAN) Protein (His-B2M&Myc)
Brand: Beta LifeScience
SKU: BLC-02907P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: Fc receptors, Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Versican Core Protein (VCAN) Protein (His-B2M&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P13611
Target Symbol	VCAN
Synonyms	Chondroitin sulfate proteoglycan 2; Chondroitin sulfate proteoglycan core protein 2; Chondroitin sulfate proteoglycan core protein; cartilage; CSPG2; CSPG2_HUMAN; ERVR; GHAP; Glial hyaluronate binding protein; Glial hyaluronate-binding protein; Large fibroblast proteoglycan; PG-M; PGM; VCAN; Versican; Versican core protein; Versican proteoglycan; WGN 1; WGN; WGN1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His-B2M&C-Myc
Target Protein Sequence	GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN
Expression Range	3089-3354aa
Protein Length	Partial
Mol. Weight	47.6 kDa
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.
Subcellular Location	Secreted, extracellular space, extracellular matrix. Cell projection, cilium, photoreceptor outer segment. Secreted, extracellular space, extracellular matrix, interphotoreceptor matrix.
Protein Families	Aggrecan/versican proteoglycan family
Database References	HGNC: 2464 OMIM: 118661 KEGG: hsa:1462 STRING: 9606.ENSP00000265077 UniGene: Hs.643801
Associated Diseases	Wagner vitreoretinopathy (WGVRP)
Tissue Specificity	Expressed in the retina (at protein level). Cerebral white matter and plasma. Isoform V0: Expressed in normal brain, gliomas, medulloblastomas, schwannomas, neurofibromas, and meningiomas. Isoform V1: Expressed in normal brain, gliomas, medulloblastomas,

Gene Functions References

VCAN expression in colorectal cancer and its role in cetuximab resistance PMID: 28320945
miR-135a-5p can suppress cell progress including cell proliferation, migration, and invasion in thyroid carcinoma by targeting VCAN 3 '-UTR. PMID: 28869452
This study highlights the oncogenic role of VCAN in renal cell carcinogenesis and suggests that this gene has therapeutic and/or biomarker potential for renal cell cancer. PMID: 28242813
Interleukin-17A promotes tongue squamous cell carcinoma metastasis by activating miR-23b/versican pathway in the tumor microenvironment. PMID: 28035060
The macular dysfunction on mfERG was profound and of early onset. A heterozygous mutation in intron 7 of the VCAN gene (c.4004-1G > A) was found. PMID: 29071374
Versican V0 and V1 isoforms were upregulated in the uterine leiomyomas of symptomatic versus asymptomatic women. Abundant cleaved versican was detected in leiomyoma and myometrium, as well as in myometrial and leiomyoma cell lines. VCAN siRNA did not effect cell proliferation, apoptosis, or smooth muscle markers, but reduced ESR1 and PR-A expression. PMID: 28323982
Lumican and versican protein expression are associated with colorectal adenoma-to-carcinoma progression PMID: 28481899
Removal or knockdown of versican may be a possible therapeutic strategy for increasing deposition of insoluble elastin and stimulating repair of elastic fibers in COPD lung. PMID: 28138236
human myeloma tumors displaying CD8(+) infiltration/aggregates underwent VCAN proteolysis at a site predicted to generate a glycosaminoglycan-bereft N-terminal fragment. PMID: 27259980
versican decreases in follicular dermal papilla as an aging-associated change of human hair follicles PMID: 27697422
Data indicate that serum versican levels were significantly decreased in polycystic ovary syndrome (PCOS) patients, and that serum ADAMTS-1 (a disintegrin and metalloproteinase with thrombospondin motif-1) and versican levels were significantly and positively correlated with each other. PMID: 27908842
the G1 domain of versican can regulate the organization of pericellular hyaluronan and affect phenotype of cultured human dermal fibroblasts PMID: 27126822
Results highlight an important role for versican in regulating the expression and assembly of elastin and the phenotype of leiomyosarcoma cells. PMID: 26723257
Versican localizes to the nucleus in proliferating mesenchymal cells and suggest role in mitotic spindle organization during cell division. PMID: 26395512
VCAN and VEGF were associated with survival in CRC patients with PM after CRS and HIPEC PMID: 26873137
Versican is a novel modulator of hepatic fibrosis. PMID: 26752747
versican mRNA is up-regulated much more highly (>600 fold) by long term hypoxia (5 days) than by 1 day of hypoxia. PMID: 26057378
Versican V1 overexpression induces a myofibroblast-like phenotype in cultured fibroblasts. PMID: 26176948
Versican upregulation in Sezary cells alters growth, motility and resistance to chemotherapy. PMID: 25915825
Versican isoform V1 is associated with high-grade gliomas. PMID: 25064688
Significant elevation of VCAN and its associated molecules imply their role in multiple myeloma PMID: 25623955
Our results suggest that TGF-beta1 up-regulates versican expression by suppressing miR-143, and this pathway is important for osteosarcoma cell migration and invasion. PMID: 25562163
Circulating monocytes may contribute to the fibrotic process in a subset of systemic sclerosis patients by amplifying a positive feedback loop consisting of versican, CCL2, and the influx of monocytes PMID: 23845159
Arylsulfatase B regulates versican expression by galectin-3 and AP-1 mediated transcriptional effects. PMID: 24240681
Versican regulates the growth of leiomyosarcoma tumors. PMID: 25320080
these data suggest that versican regulates the development of peritoneal metastasis originating from cells and spheroids. PMID: 24999371
The ADAMTS5 ancillary domain and specific chondroitin sulfate chains of versican are required for proteolysis. PMID: 25122765
Versican expression in tumor epithelial cells predicts a good prognosis for gastric cancer patients. PMID: 25275064
Lack of versican expression is associated with recurrence in colon cancer. PMID: 22711178
CD26 expression on T-anaplastic large cell lymphoma (ALCL) line Karpas 299 is associated with increased expression of versican and MT1-MMP and enhanced adhesion. PMID: 24180670
FoxQ1 promotes hepatocellular carcinoma metastasis by transactivating ZEB2 and VersicanV1 expression. PMID: 24005989
A novel c.4004-6T>A nucleotide substitution at the acceptor splice site of intron 7 of the VCAN gene that segregated with the Wagner disease phenotype, was identified. PMID: 24174867
Cleaved versican G1 domain-containing fragments (VG1F) can be recaptured by microfibrils through VG1F homotypical interactions to enhance hyaluronan recruitment to microfibrils. PMID: 23963449
altered balance of VCAN splice variants in combination with reduction in glycosaminoglycan protein modifications as pathogenic mechanisms in Wagner syndrome PMID: 22739342
Letter/Case Report: disease causing versican mutation in Wagner syndrome. PMID: 23571384
versican V1 enhances hCAP18/LL-37 expression in macrophages through activation of TLR2 and subsequent vitamin D-dependent mechanisms which promote ovarian tumor progression in vitro PMID: 23424670
No association has been found between polymorphisms of rs251124 and rs3767137 loci of CSPG2 and HSPG2 genes and intracranial aneurysm in the selected population. PMID: 23568740
Wnt/beta-catenin signal transducting system regulates dermal papilla cell aggregative growth through modifying versican expression by means of acting on the versican gene upstream promoter. PMID: 23099107
these results demonstrate that versican V0 and V1 isoforms play important roles in HCC development and that versican mRNAs compete with endogenous RNAs in regulating miRNA functions. PMID: 23180826
Mesenchymal cells derived from keloid lesion (KL) cells exhibit above-normal versican production. PMID: 22951719
the glioblastoma cell line U87 stably transfected with versican isoform V2 formed tumors containing extensive vasculature PMID: 23201264
renal versican expression was significantly upregulated as compared to corresponding controls. These data show for the first time an association of renal versican isoform V0 and V1 expression with progressive renal disease. PMID: 23024773
Studies indicate that E-cadherin and versican are involved in cancer epithelial-mesenchymal transitions and metastasis. PMID: 23002209
Tissue microarray analysis revealed that epithelial expression of versican had significant relations to lymph node metastasis and pathological stages of breast cancer PMID: 22318369
E(2) treatment increases the amount of dermal HA and versican V2 via paracrine release of EGF, which may be implicated in the pro-proliferative and anti-inflammatory effects of E(2) during photoaging. PMID: 22493503
The major isoforms expressed by gastric carcinoma & gastric cell lines were V0 & V1. V1 was higher in gastric carcinoma. Abnormally expressed versican & its isoforms participate in the progress of gastric carcinoma triggered by IL-11. PMID: 22393310
RhoGDI2 suppresses lung metastasis in mouse models by reducing the expression of isoforms V1 and V3 of the proteoglycan versican, which is require for lung metastasis. High versican levels portended poor prognosis in patients with bladder cancer. PMID: 22406535
Hyaluronan and versican play a role in T-cell trafficking and function in inflamed tissues. PMID: 22155153
Versican is a key component of the provisional wound repair ECM that is expressed following injury to valvular interstitial cells. PMID: 21546273
the G1 and G3 domains of versican were upregulated and LTBP-4 was downregulated in breast cancer stroma PMID: 21505857

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.