Recombinant Human Visfatin Protein

Name: Recombinant Human Visfatin Protein
Brand: Beta LifeScience
SKU: BLA-1185P
Availability: InStock

Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	P43490
Synonym	1110035O14Rik AI314458 AI480535 DKFZP666B131 EC 2.4.2.12 MGC117256 NAmPRTase Nampt NAMPT_HUMAN Nicotinamide phosphoribosyltransferase PBEF PBEF 1 PBEF1 Pre B cell colony enhancing factor Pre B cell colony enhancing factor 1 Pre B cell enhancing factor Pre-B cell-enhancing factor Pre-B-cell colony-enhancing factor 1 VF Visfatin
Description	Recombinant Human Visfatin Protein was expressed in E.coli. It is a Protein fragment
Source	E.coli
AA Sequence	MPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYLKGKVV TKEKIQEAKDVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEGFVI PRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKY LLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLA LIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVS VVSDSYDIYNACEKIWGEDLRHLIVSRSTQAPLIIRPDSGNPLDTVLKVL EILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINTLQEIVEGMKQKMWSI ENIAFGSGGGLLQKLTRDLLNCSFKCSYVVTNGLGINVFKDPVADPNKRS KKGRLSLHRTPAGNFVTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDE IRKNAQLNIELEAAHH
Molecular Weight	53 kDa
Purity	>90% SDS-PAGE.Determined by Reducing and Non-reducing SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity	The activity is determined by its ability to induce IL-6, IL-1 beta and TNF alpha production from Human PBMCs at 100 ng/mL.
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA). This product is an active protein and may elicit a biological response in vivo, handle with caution.

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.