Recombinant Human Wnt4 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-1195P
Recombinant Human Wnt4 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-1195P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P56705-1 |
Synonym | MGC123964 Protein Wnt-4 RP23-246F18.1 SERKAL Wingless type MMTV integration site family member 4 precursor WNT 4 WNT 4 protein precursor WNT4 WNT4_HUMAN |
Description | Recombinant Human Wnt4 Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | SNWLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRNLEVMDSVRRGAQ LAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGVAF AVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDV RERSKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWR AVPPFRQVGHALKEKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVY LEPSPDFCEQDMRSGVLGTRGRTCNKTSKAIDGCELLCCGRGFHTAQVEL AERCSCKFHWCCFVKCRQCQRLVELHTCR |
Molecular Weight | 53 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |