Recombinant Human Wnt5a Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-1197P

Recombinant Human Wnt5a Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-1197P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Human
Accession P41221
Synonym hWNT 5A hWNT5A Protein Wnt 5a Protein Wnt-5a Protein Wnt5a Wingless type MMTV integration site family member 5A Wnt 5a WNT 5A protein WNT 5A protein precursor WNT5A WNT5A protein precursor WNT5A_HUMAN
Description Recombinant Human Wnt5a Protein (His tag) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence IIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHR RWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELST CGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGSY ESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRK VGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLVYIDPSPDYCVR NESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHW CCYVKCKKCTEIVDQFVCK
Molecular Weight 40 kDa including tags
Purity >85% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function Ligand for members of the frizzled family of seven transmembrane receptors. Can activate or inhibit canonical Wnt signaling, depending on receptor context. In the presence of FZD4, activates beta-catenin signaling. In the presence of ROR2, inhibits the canonical Wnt pathway by promoting beta-catenin degradation through a GSK3-independent pathway which involves down-regulation of beta-catenin-induced reporter gene expression. Suppression of the canonical pathway allows chondrogenesis to occur and inhibits tumor formation. Stimulates cell migration. Decreases proliferation, migration, invasiveness and clonogenicity of carcinoma cells and may act as a tumor suppressor. Mediates motility of melanoma cells. Required during embryogenesis for extension of the primary anterior-posterior axis and for outgrowth of limbs and the genital tubercle. Inhibits type II collagen expression in chondrocytes.
Subcellular Location Secreted, extracellular space, extracellular matrix. Secreted.
Protein Families Wnt family
Database References
Associated Diseases Robinow syndrome, autosomal dominant 1 (DRS1)
Tissue Specificity Expression is increased in differentiated thyroid carcinomas compared to normal thyroid tissue and anaplastic thyroid tumors where expression is low or undetectable. Expression is found in thyrocytes but not in stromal cells (at protein level). Detected i

Gene Functions References

  1. Impaired Wnt5a signaling is associated with poor placentation and subsequent development of preeclampsia. PMID: 30177057
  2. Decreased hepatic Wnt5a signaling is associated with hepatocellular carcinoma progression and poor prognosis. PMID: 29709351
  3. Annotation of rs11918967 in WNT5A in tissues might be related to obesity. PMID: 28272483
  4. Wnt5a expression is critical for proliferation of RL and VZ progenitors and Purkinje cell dendritogenesis during early embryonic development resulting in retarded development of cerebellum during postnatal stages. PMID: 28205531
  5. Study shows that Wnt5a is upregulated in invasive glioblastoma tissues, and demonstrates that it may regulate the invasion of glioblastoma cells, at least in part via the Daam1/RhoA signaling pathway. PMID: 29207169
  6. The findings suggest that Wnt5a expression may be involved in the inhibition of cell differentiation and the induction of an inflammatory response. PMID: 29286164
  7. High WNT5A expression is associated with gliomas PMID: 28627699
  8. Wnt5a promotes epithelial-to-mesenchymal transition and metastasis in non-small-cell lung cancer, which is involved in the activation of beta-catenin-dependent canonical Wnt signaling. PMID: 29054966
  9. This study suggests that methylation of Wnt pathway genes, in addition to known CpG island methylator phenotype markers, may help predict treatment outcome and survival in patients with CRC[colorectal cancer. PMID: 29869456
  10. non-canonical Wnt5a signalling could play a role in early human trophoblast development by promoting cell proliferation and survival. PMID: 27311852
  11. These findings suggest that WNT-5A modulates fundamental mechanisms that affect airway smooth muscle contraction and thus may be of relevance for airway hyperresponsiveness in asthma. PMID: 27468699
  12. We performed immunohistochemistry for Ki67, p16INK4a, and WNT5A in human HPs ( hyperplastic polyps), sessile serrated adenomas/polyps (SSA/Ps), and traditional serrated adenomas (TSAs) .The distribution of Ki67 and p16INK4a positive cells in TSAs was different from that in HPs and SSA/Ps. PMID: 28627675
  13. Wnt5a-Ror2 signaling enhanced tongue SCC cell aggressiveness and promoted production of MMP-2 following DeltaNp63beta-mediated EMT PMID: 28559016
  14. Here, the authors define WNT5A, a non-canonical Wnt ligand implicated in epithelial differentiation, repair, and cancer, as a direct transcriptional target that is activated by KLF4 in squamous epithelial cells. PMID: 27184424
  15. These findings support that Wnt5a-Ror2 signaling plays a role in UC, support the potential use of Wnt5a as a prognostic marker and provide evidence that Wnt5a signaling may be used as an effective molecular target for novel therapeutic tools. PMID: 28427201
  16. We show that rosiglitazone increases klotho and decreases Wnt5A in tumor cells, reducing the burden of both BRAF inhibitor-sensitive and BRAF inhibitor-resistant tumors in aged, but not young mice. However, when used in combination with PLX4720, tumor burden was reduced in both young and aged mice, even in resistant tumors PMID: 28232477
  17. Serum Wnt5a is elevated and associated with disease severity in heart failure patients. PMID: 28357477
  18. In squamous/adenosquamous carcinoma and adenocarcinoma of the gallbladder positive ROR2 or WNT5a expression is generally associated with a poor prognosis. PMID: 28465645
  19. The Wnt5a and its signaling pathway can regulate fundamental cellular processes, including specification of cell fate, proliferation, and survival. PMID: 28641961
  20. Results show that PTEN and WNT5A expression are directly repressed by miR-26b which promotes colorectal cancer metastasis. PMID: 29160937
  21. The relationship between Wnt5a protein expression and histone H4K20me1 was analyzed. Recruitment of H4K20me1 and SET8 to the Wnt5a promoter and coding regions wa investigated. Results demonstrated that the expression levels of Wnt antagonists were generally low in acute myeloid leukemia (AML), but showed differential expression in acute lymphocytic leukemia (ALL). PMID: 28440495
  22. WNT5A and IL-6 are connected through a positive feedback loop in melanoma cells PMID: 27191257
  23. this study reveals that 14-3-3zeta plays a critical role in Wnt5a/ROR1 signaling, leading to enhanced CLL migration and proliferation. PMID: 28465528
  24. these studies indicate HS1 plays an important role in ROR1-dependent Wnt5a-enhanced chemokine-directed leukemia-cell migration. PMID: 28465529
  25. Study reports that WNT5A bi-directionally regulates epithelial-mesenchymal transition (EMT) in mammary epithelial cells, thereby affecting their migration and invasion. However, the ability of WNT5A to inhibit breast cancer cell migration and invasion is an EMT-independent mechanism that, at least in part, can be explained by decreased CD44 expression. PMID: 27623766
  26. disruption of trans-spliced noncoding RNA RMST expression in human embryonic stem cells results in the upregulation of WNT5A, epithelial-to-mesenchymal transition, and lineage-specific genes/markers. PMID: 27090862
  27. Wnt5a suppressed osteoblastic differentiation through Ror2/JNK signaling in periodontal ligament stem cell-like cells. PMID: 28681925
  28. Genetic blockade of autophagy indicated an unexpected feedback loop whereby knocking down the autophagy factor ATG5 in Wnt5A(high) cells decreased Wnt5A and increased beta-catenin. PMID: 28887323
  29. Low WNT5A expression is associated with prostate cancer. PMID: 28748258
  30. WNT5A signaling regulates 15-PGDH expression. PMID: 27522468
  31. our study showed that, for the first time, different Wnt5a mRNA isoforms play distinct roles in colorectal cancer (CRC) and can be used as novel prognostic markers for CRC in the future. PMID: 28859077
  32. High WNT5a expression is associated with osteoarthritis. PMID: 28777797
  33. We conclude that in RS, WNT5A missense mutations have dominant neomorphic effects that interfere with the function of the wild-type protein. PMID: 28662348
  34. RSPO2 suppresses colorectal cancer metastasis by counteracting the Wnt5a/Fzd7-driven noncanonical Wnt pathway. PMID: 28600110
  35. High expression of WNT5A is associated with squamous cell lung carcinoma. PMID: 27876017
  36. Study shows that WNT5A stimulates dimerization of membrane-anchored FZD4 CRDs and oligomerization of full-length FZD4, which requires the integrity of CRD palmitoleoyl-binding residues. These results suggest that FZD receptors may form signalosomes in response to Wnt binding through the CRDs and that the Wnt palmitoleoyl group is important in promoting these interactions. PMID: 28546512
  37. Taken together with our previous findings, we have replicated our results from the rodent system in a novel human system. We have revealed a unique sequential cascade involving Atg10, Wnt5a, alpha1 integrin, and matrix metalloproteinase-3 in GS/BMP-4-induced differentiation of hiPS cells into odontoblast-like cells at a relatively early stage. PMID: 27639333
  38. Elevated WNT5A expression in obesity may function as a negative regulator of angiogenesis.NEW & NOTEWORTHY Wingless-related integration site 5a (WNT5A) negatively regulates adipose tissue angiogenesis via VEGF-A165b in human obesity. PMID: 28411232
  39. Wnt5a as a master regulator of brain invasion, specifically tumor-promoting stem-like characteristics (TPC), and they provide a therapeutic rationale to target it in patients with glioblastoma. PMID: 28011620
  40. inhibition of WNT-5A in vivo attenuated lung tissue destruction, improved lung function, and restored expression of beta-catenin-driven target genes and alveolar epithelial cell markers in the elastase, as well as in cigarette smoke induced models of COPD. PMID: 27979969
  41. Wnt5A/Ryk signaling might provide novel therapeutic strategies to prevent capillary leakage in systemic inflammation and septic shock. PMID: 27159116
  42. Profound vascular insulin resistance in the visceral adipose tissue arterioles of obese subjects was associated with up-regulated WNT5A-JNK signaling and impaired endothelial eNOS activation. PMID: 27688298
  43. Aberrant activation of WNT pathways in patients with ESRD significantly correlated with vascular calcification. PMID: 27156072
  44. Wnt5A could be a potential therapeutic target for reducing microvascular leakage and edema formation in Th2 driven inflammatory diseases. PMID: 27214384
  45. WNT5A and ROR2 are induced by inflammatory mediators through NF-kB and STAT3 transcription factors, and are involved in the migration of human ovarian cancer cell line SKOV-3. PMID: 28536612
  46. decreased UHRF1 expression is a key initial event in the suppression of DNMT1-mediated DNA methylation and in the consequent induction of senescence via increasing WNT5A expression PMID: 28100769
  47. TrpC5 causes a robust rise in [Ca2+]i, enhanced Wnt5a expression and nuclear translocation of beta-catenin, leading to reduced differentiation and enhanced cancer cell stemness. PMID: 27895148
  48. This study describes the localization and functional role of WNT-5A in human and mouse fibrotic livers. Hepatic WNT-5A expression parallels collagen type I expression. In vivo and in vitro, the myofibroblasts were identified as the key hepatic cells producing WNT-5A. WNT-5A is under control of TGF-beta and its activities are primarily profibrotic. PMID: 28057611
  49. this study shows that Wnt5a promotes differentiation of dendritic cells, but inhibits their maturation PMID: 27641635
  50. we confirmed the requirement of Wnt5a in the deferoxamine-mediated osteoblast-promoting effects by analyzing the matrix mineralization of Wnt5a-deficient cells. The promoting effect of deferoxamine on matrix mineralization in wild-type cells was completely abolished in Wnt5a(-/-) cells. PMID: 27540134

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed