Recombinant Human Wnt9b Protein
Beta LifeScience
SKU/CAT #: BLA-1206P
Recombinant Human Wnt9b Protein
Beta LifeScience
SKU/CAT #: BLA-1206P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | O14905 |
Synonym | MGC124412 Protein Wnt 9b precursor Protein Wnt-14b Protein Wnt-9b Wingless type MMTV integration site 9B Wingless type MMTV integration site family member 15 Wingless type MMTV integration site family member 9B Wnt 14b Wnt-15 Wnt14b Wnt15 Wnt9b wingless type MMTV integration site family member 9B |
Description | Recombinant Human Wnt9b Protein was expressed in CHO cells. It is a Full length protein |
Source | CHO cells |
AA Sequence | SYFGLTGREVLTPFPGLGTAAAPAQGGAHLKQCDLLKLSRRQKQLCRREP GLAETLRDAAHLGLLECQFQFRHERWNCSLEGRMGLLKRGFKETAFLYAV SSAALTHTLARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKF LSNFLGSKRGNKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVR TCWKQLSPFRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTK GLAPRSGDLVYMEDSPSFCRPSKYSPGTAGRVCSREASCSSLCCGRGYDT QSRLVAFSCHCQVQWCCYVECQQCVQEELVYTCKH |
Molecular Weight | 37 kDa |
Purity | >= 95% SDS-PAGE.At least 95% by HPLC analysis. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Determined by its ability to induce alkaline phosphatase production by CCL-226 cells. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |