Recombinant Mouse APOA4/Apo-AIV Protein (His tag)

Name: Recombinant Mouse APOA4/Apo-AIV Protein (His tag)
Brand: Beta LifeScience
SKU: BLA-0071P
Availability: InStock

Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Mouse
Accession	P06728
Synonym	Apo AIV APOA 4 ApoA IV APOA4 Apolipoprotein A IV Apolipoprotein A4 MGC142154 MGC142156
Description	Recombinant Mouse APOA4/Apo-AIV Protein (His tag) was expressed in Yeast. It is a Full length protein
Source	Yeast
AA Sequence	EVTSDQVANVVWDYFTQLSNNAKEAVEQFQKTDVTQQLSTLFQDKLGDAS TYADGVHNKLVPFVVQLSGHLAQETERVKEEIKKELEDLRDRMMPHANKV TQTFGENMQKLQEHLKPYAVDLQDQINTQTQEMKLQLTPYIQRMQTTIKE NVDNLHTSMMPLATNLKDKFNRNMEELKGHLTPRANELKATIDQNLEDLR RSLAPLTVGVQEKLNHQMEGLAFQMKKNAEELQTKVSAKIDQLQKNLAPL VEDVQSKVKGNTEGLQKSLEDLNRQLEQQVEEFRRTVEPMGEMFNKALVQ QLEQFRQQLGPNSGEVESHLSFLEKSLREKVNSFMSTLEKKGSPDQPQAL PLPEQAQEQAQEQAQEQVQPKPLES
Molecular Weight	45 kDa including tags
Purity	>90% SDS-PAGE
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	May have a role in chylomicrons and VLDL secretion and catabolism. Required for efficient activation of lipoprotein lipase by ApoC-II; potent activator of LCAT. Apoa-IV is a major component of HDL and chylomicrons.
Subcellular Location	Secreted.
Protein Families	Apolipoprotein A1/A4/E family
Database References	KEGG: mmu:11808 STRING: 10090.ENSMUSP00000034585 UniGene: Mm.4533
Tissue Specificity	Secreted in plasma.

Gene Functions References

This study uncovers an anti-sense lncRNA (APOA4-AS), which is co-expressed with APOA4, and concordantly and specifically regulates APOA4 expression both in vitro and in vivo with the involvement of HuR. PMID: 27131369
Our findings may throw light on the function of ApoA4 in inflammatory responses and acute-phase reactions, as well as the development of SERPINA3 relative diseases. PMID: 28412351
Very Low Density Lipoprotein (VLDL) assembly and CREBH activation play key roles in the response to hepatic steatosis by up-regulating apoA-IV and promoting assembly and secretion of larger, more triglyceride - enriched VLDL particles. PMID: 27655915
It was suggested that increased ileal GPR119 is a potential mechanism by which GLP-1 secretion is enhanced in apoA-IV-/- mice. PMID: 26294669
these data suggest that apoA-IV is not necessary for the metabolic improvements shown with VSG, but also suggest an interesting role for apoA-IV in regulating macronutrient preference and hepatic triglyceride levels. PMID: 25157093
These results reveal ApoA-IV as a novel follicle-associated epithelium-specific marker especially in the upper small intestine of adult mice. PMID: 24838500
transcriptional regulation of apolipoprotein A-IV by the transcription factor CREBH PMID: 24598141
apoA-IV inhibits hepatic gluconeogenesis by decreasing Glc-6-Pase and PEPCK gene expression through NR1D1. PMID: 24311788
Hepatic steatosis in mice induces hepatic apoA-IV expression, which in turn promotes lipoprotein particle expansion and reduces hepatic lipid burden without increasing the number of secreted atherogenic apoB-containing lipoprotein particles. PMID: 24030551
Data indicate that plasma lipids, lipid absorption, and microsomal triglyceride transfer protein (MTP), FoxO1, and FoxA2 levels are lower at night and at mealtime in apoAIV-/- mice. PMID: 23729668
a novel function of apoA-IV in the biogenesis of discrete HDL-A-IV particles with the participation of ABCA1 and LCAT PMID: 23132909
peripheral apo AIV requires an intact CCK system and vagal afferents to activate neurons in the hindbrain to reduce food intake PMID: 23027805
results suggest that apoA-IV may provide a therapeutic target for the regulation of glucose-stimulated insulin secretion and treatment of diabetes PMID: 22619326
Data show that ApoA4 is a true target gene of LUMAN in bone marrow-derived DCs (BMDCs). PMID: 22209087
These data suggest that Apoa4 has a previously unknown role in mediating the metabolism of chylomicrons, and therefore may be important in regulating plasma lipid metabolism. PMID: 22207575
apoA-IV may play a unique role in integrating feeding behavior, intestinal lipid absorption, and energy storage PMID: 21840868
ApoA-IV deficiency increases Abeta deposition and results in cognitive damage in the mouse model. PMID: 21356380
ApoA-IV restriction to enterocyte is controlled by a new hormone-response element. PMID: 12105231
Results provide the first direct support for the hypothesis that apolipoprotein A-IV is an endogenous anti-inflammatory protein. PMID: 15254593
apo A-IV and apo A-V are positive acute-phase proteins in mouse HDL PMID: 15306172
results demonstrate that apoA-IV is a direct ERRalpha target gene and suggest a function for ERRalpha in intestinal fat transport, a crucial step in energy balance PMID: 15466464
the induction of apoA-IV expression in fasting and diabetes likely involves PGC-1 alpha-mediated coactivation of HNF-4 alpha in addition to glucocorticoid-dependent actions PMID: 16929032
The hypothalamic apo A-IV is regulated by leptin, at least partially, via the STAT3 signaling pathway. PMID: 17363460
Role for apo A-IV and CCK(1)R in PYY(3-36)-induced activation of vagal afferent pathway and inhibition of gastric emptying, but this is likely not pathway mediating effects of PYY(3-36) on food intake. PMID: 17641001
the apoCIII enhancer contributes to the maintenance of an active chromatin subdomain of the apoAI/CIII/AIV genes, but not apoAV PMID: 18678879

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.