Recombinant Mouse BAFF Protein
Beta LifeScience
SKU/CAT #: BLA-0116P
Recombinant Mouse BAFF Protein
Beta LifeScience
SKU/CAT #: BLA-0116P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q9WU72 |
Synonym | ApoL related ligand TALL 1 B cell Activating Factor B lymphocyte stimulator B-cell-activating factor BAFF BLyS CD 257 CD257 CD257 antigen Delta BAFF Dendritic cell derived TNF like molecule Dendritic cell-derived TNF-like molecule DTL DTL precursor PRO738 soluble form TALL 1 TALL-1 TALL1 THANK TN13B_HUMAN TNF and APOL related leukocyte expressed ligand 1 TNF homolog that activates apoptosis TNF homolog that activates apoptosis NKFB and JNK. TNF- and APOL-related leukocyte expressed ligand 1 TNFSF13B TNFSF20 TNLG7A Tumor necrosis factor (ligand) superfamily member 13b Tumor necrosis factor ligand 7A Tumor necrosis factor ligand superfamily member 13b Tumor necrosis factor ligand superfamily member 20 Tumor necrosis factor like protein ZTNF4 Tumor necrosis factor superfamily member 13B UNQ401 ZTNF4 |
Description | Recombinant Mouse BAFF Protein was expressed in HEK293. It is a Full length protein |
Source | HEK293 |
AA Sequence | AFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIAD SDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYT DPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIAR LEEGDEIQLAIPRENAQISRNGDDTFFGALKLL |
Molecular Weight | 17 kDa including tags |
Purity | >95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Binds to Human (weak) and mouse BCMA, TACI and BAFF-R.Mediates splenocyte survival. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C. |