Recombinant Mouse Beta-Nerve Growth Factor (NGF), Active

Name: Recombinant Mouse Beta-Nerve Growth Factor (NGF), Active
Brand: Beta LifeScience
SKU: BLC-05999P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Cytokines, Cytokines and growth factors, Growth factors and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Beta-Nerve Growth Factor (NGF), Active is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined in a cell proliferation assay using TF-1 human erythroleukemic cells is less than 2 ng/ml.
Uniprotkb	P01139
Target Symbol	NGF
Synonyms	Ngf; Ngfb; Beta-nerve growth factor; Beta-NGF
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	Tag-Free
Complete Sequence	SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG
Expression Range	122-241aa
Protein Length	Full Length of Mature Protein
Mol. Weight	13.5 kDa
Research Area	Neuroscience
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm Filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades to regulate neuronal proliferation, differentiation and survival. The immature NGF precursor (proNGF) functions as ligand for the heterodimeric receptor formed by SORCS2 and NGFR, and activates cellular signaling cascades that lead to inactivation of RAC1 and/or RAC2, reorganization of the actin cytoskeleton and neuronal growth cone collapse. In contrast to mature NGF, the precursor form (proNGF) promotes neuronal apoptosis (in vitro). Inhibits metalloproteinase-dependent proteolysis of platelet glycoprotein VI. Binds lysophosphatidylinositol and lysophosphatidylserine between the two chains of the homodimer. The lipid-bound form promotes histamine relase from mast cells, contrary to the lipid-free form.
Subcellular Location	Secreted. Endosome lumen.
Protein Families	NGF-beta family
Database References	KEGG: mmu:18049 STRING: 10090.ENSMUSP00000102538 UniGene: Mm.1259
Tissue Specificity	Detected in submaxillary gland (at protein level). Highly expressed in male submaxillary gland. Levels are much lower in female submaxillary gland.

Gene Functions References

The authors described a long-distance signaling mechanism of Porcine hemagglutinating encephalomyelitis virus-driven deficits in neurons and suggested that such Ulk1 repression may result in limited NGF/TrkA retrograde signaling within activated Rab5 endosomes, explaining the progressive failure of neurite outgrowth and survival. PMID: 29875237
Mechanoinsensitive ''silent'' nociceptors are characterized by the expression of the nicotinic acetylcholine receptor subunit alpha-3 (CHRNA3); the mechanically gated ion channel PIEZO2 mediates NGF-induced mechanosensitivity in these neurons. PMID: 29241539
antibodies raised against NGF, TrkA, and p75 (also known as CD271) were used to explore the expression of these antigens in the non-decalcified young mouse femur. PMID: 29166838
An inducible mouse model that can dissect the contribution of autocrine direct action of cleavage-resistant proNGF on systemic microvascular abnormalities in both retina and kidney, major targets for microvascular complication. PMID: 29253516
both in vivo mechanical loading and in vitro mechanical stretch were shown to induce the profound up-regulation of NGF in osteoblasts within 1 h of loading. PMID: 28416686
Nerve growth factor negatively regulates bone marrow granulopoiesis during small intestinal inflammation PMID: 26683342
This study may represent a common mechanism for selective follicular activation induced by a localized increase in NGF in interstitial cells and mediated via the mTOR signaling pathway. PMID: 28542147
nerve growth factor (NGF) signaling through neurotrophic tyrosine kinase receptor type 1 (TrkA) directs innervation of the developing mouse femur to promote vascularization and osteoprogenitor lineage progression. PMID: 27568565
Mechanical stress-induced upregulation of NGF in colon SMC underlies the visceral hypersensitivity in bowel obstruction through increased gene expression and activity of tetrodotoxin-resistant Na channels in sensory neurons. PMID: 28079757
results suggest that perivascular nerves innervate neovessels as neovasculatures mature and that NGF accelerates the innervation of perivascular nerves in neovessels. PMID: 27493098
These findings reveal a non-neuronal role for neurotrophins and identify a new regulatory pathway in insulin secretion that can be targeted to ameliorate beta cell dysfunction. PMID: 27825441
NGF signalling directly controls basal APP phosphorylation, subcellular localization and BACE cleavage. PMID: 27076121
NGF facilitates OVA with lowLPS-induced maturation of mouse BMDCs through LPS-up-regulated p75 NTR via activation of NF-kappaB pathways, providing another mechanism for the involvement of NGF in the Th2 response PMID: 27437725
NGF-OE mice exhibit age-dependent increases in Substance P and CGRP in the urothelium and hyperinnervation of the bladder. PMID: 27342083
TNF-alpha upregulated Nerve Growth Factor [NGF] expression in synovial fibroblasts and macrophages and IL-1beta upregulated NGF expression in synovial fibroblasts. IL-1beta and TNF-alpha may regulate NGF signaling in Osteoarthritic joints and be suitable therapeutic targets for treating Osteoarthritis pain PMID: 27635406
functional PAP(thorn) neurons are essential for the analgesic effect, which is mediated by NGF-trkA signaling. PMID: 27306411
NGF negatively regulates growth cone retrograde actin flow on laminin. PMID: 26631553
In E-Reeler retinas, NGF was significantly increased in retinal ganglion cells and glial cells. E-Reeler retinal bipolar cells and RGCs overexpress NGF and p75(NTR) as a protective endogenous response to Reelin deprivation. PMID: 26066836
The NGF-induced up-regulation of TRPV1 via the increased synthesis and release of endogenous CGRP leads to improved cardiac performance in I/R-injured diabetic heart. PMID: 25650182
NGF effects on parasympathetic nerves may regulate airway smooth muscle. PMID: 25647301
Ginger extract has a synaptogenic effect via NGF-induced ERK/CREB activation, resulting in memory enhancement. PMID: 25049196
Proinflammatory cytokines in osteoarthritis (OA) joints and the increased mechanical loading of cartilage may mediate OA pain via the stimulation of NGF expression and release by chondrocytes PMID: 24438745
Despite being highly conserved, NGF and proNGF of mouse and human origins show distinct properties.Special care must be taken in performing experiments with cross-species systems. PMID: 25496838
NGF exhibits anti-oxidative and hepatoprotective effects and is suggested to be therapeutically applicable in treating cholestatic liver diseases. PMID: 25397406
Results indicate that analgesic effect of CB1 activation may in part be due to inhibition of NGF-induced sensitization of TRPV1 and also that the effect of CB1 activation is at least partly mediated by attenuation of NGF-induced increased PI3 signaling PMID: 25088915
NGF induces removal of active caspase-3 in a lysosome-dependent manner. PMID: 24787014
These results indicate that NGF exerts antileishmanial effect by stimulating hydrogen peroxide production in macrophages. PMID: 24937592
iron accumulation induces NGF expression in hepatocytes, which in turn leads to LSEC defenestration via TrkA PMID: 25460199
These findings suggest that overexpression of NGF in the ovary may suffice to cause both reproductive and metabolic alterations characteristic of polycystic ovary-like syndrome (PCOS) and support the hypothesis that sympathetic hyperactivity may contribute to the development and/or progression of PCOS. PMID: 25211588
The increased NGF concentrations abolish Sema3A-induced inhibitory effect on axon outgrowth, while they have no effect on Sema3A-induced collapse rate. PMID: 24338202
Data suggest that proNGF may appeal a new pathway or possible mechanism underlying microglial toxicity in the neuroinflammation and a potential target for therapeutic manipulation of the neurodegenerative diseases. PMID: 24040063
beta-NGF gene transfection promotes the differentiation of bone marrow stromal stem cells into neurons through regulation of AKT and MAPKs signaling pathways. PMID: 23934089
mechanical stimulation may attenuate NGFbeta signaling through Rac1 PMID: 23989259
Independent of genotype, folate deficiency affects NGF levels in the frontal cortex, amygdala and hippocampus. PMID: 23623989
calcineurin/NFAT pathway mediates the upregulation of PAI-1 by NGF PMID: 23825664
ProNGF\NGF imbalance triggers learning and memory deficits, neurodegeneration and spontaneous epileptic-like discharges in transgenic mice. PMID: 23538417
elevated levels of NGF in target tissues stimulate sympathetic and sensory axonal sprouting PMID: 23322532
PIP5Kalpha acts as a negative regulator of nerve growth factor-induced neurite outgrowth by inhibiting PI3K/Akt signaling pathway in PC12 cells. PMID: 23538529
Data suggest that diet factors (i.e., olive pomace polyphenols) up-regulate NGF/TrkA (proto-oncogene trk) and BDNF/TrkB (brain derived neurotrophic factor/receptor) in hippocampus/olfactory bulb and down-regulate NGF/BDNF in frontal cortex/striatum. PMID: 23466052
Data suggest that expression of NGF is down-regulated in wounded skin (epidermis) in diabetes; among the growth factors investigated, only expression of NGF was down-regulated in healing skin wounds of diabetic mice as compared to nondiabetic mice. PMID: 23426701
proNGF selectively promotes the growth of neurites from a subset of NGF-responsive neurons by a p75(NTR)-dependent mechanism during postnatal development when the axons of these neurons are ramifying within their targets in vivo PMID: 23633509
Overexpression of mouse NGF in urothelium & detrusor affected transcription of PAC1, VPAC1, VPAC2, PAPCAP, VIP & other peptides normally & in cyclophosphamide-induced cystitis. The changes were tissue- and disease-duration dependent. PMID: 22700375
The HTM1 heterodimer of 2 NGF muteins binds p75 and TrkA on opposite sides of the heterodimer, but not 2 TrkA receptors, supporting the ligand passing of NGF from p75 to TrkA via a transient heteroreceptor complex of p75-NGF-TrkA. PMID: 22903500
Our results suggest that BDNF-TrkB but not NGF-TrkA signaling is involved in the brain repair after ICH, and early proper treadmill exercise might promote this repair process. PMID: 22999926
Expression of NGF in hippocampus, cortex, and adrenal gland of wild type animal tended to decrease following spaceflight. PMID: 22808101
This study demonstrated that both TrkA and NGF support the survival of only a subset of basal forebrain cholinergic neuron during brain development. PMID: 23100411
Letter: NGF-p75 and neuropsin/KLK8 pathways may cooperate in regulation of epidermal homeostasis in inflamed skin. PMID: 22520925
that NGF derived from bronchial and alveolar epithelium plays an important role in airway hyperresponsiveness after chronic exposure to mite antigen PMID: 22168511
Therapeutic potential of NGF for the prevention of cardiomyopathy in diabetic subjects. PMID: 22187379
NGF exerts profibrotic activities in the airways by inducing type III collagen production in fibroblasts PMID: 21816457

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.