Recombinant Mouse BMP4 Protein
Beta LifeScience
SKU/CAT #: BLA-0163P
Recombinant Mouse BMP4 Protein
Beta LifeScience
SKU/CAT #: BLA-0163P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P21275 |
Synonym | zgc:100779 BMP 2B BMP 4 BMP-2B BMP-4 BMP2B BMP2B1 BMP4 BMP4_HUMAN Bone morphogenetic protein 2B Bone morphogenetic protein 4 DVR4 MCOPS6 MGC100779 OFC11 zbmp-4 ZYME |
Description | Recombinant Mouse BMP4 Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | KKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNST NHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVV EGCGCR |
Molecular Weight | 12 kDa |
Purity | >= 98% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 for this effect is 5-15 ng/ml. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |