Recombinant Mouse C-C Motif Chemokine 4 (CCL4) Protein (His)

Beta LifeScience SKU/CAT #: BLC-03454P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Mouse C-C Motif Chemokine 4 (CCL4) Protein (His)

Beta LifeScience SKU/CAT #: BLC-03454P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse C-C Motif Chemokine 4 (CCL4) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P14097
Target Symbol CCL4
Synonyms Ccl4; Mip1b; Scya4; C-C motif chemokine 4; Immune activation protein 2; ACT-2; ACT2; Macrophage inflammatory protein 1-beta; MIP-1-beta; Protein H400; SIS-gamma; Small-inducible cytokine A4
Species Mus musculus (Mouse)
Expression System E.coli
Tag N-6His
Target Protein Sequence APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
Expression Range 24-92aa
Protein Length Full Length of Mature Protein
Mol. Weight 11.8 kDa
Research Area Immunology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Monokine with inflammatory and chemokinetic properties.
Subcellular Location Secreted.
Protein Families Intercrine beta (chemokine CC) family
Database References

Gene Functions References

  1. CCL4-CCR5 axis can contribute to breast cancer metastasis to bone by mediating the interaction between cancer cells and fibroblasts in bone cavity. PMID: 27177471
  2. YY1 regulates lung CCL4 transcription in pulmonary tuberculosis. PMID: 26786659
  3. Ccl4 mRNAs increased within 5 h after injury in mouse cortical slices. PMID: 25895671
  4. CCL4 and CCL5 expression was higher in livers of infected WSX-1(-/-) mice than infected WT mice, and hepatic CD4 T cells from WSX-1(-/-) mice expressed higher levels of CCR5 than cells from WT mice PMID: 24244314
  5. CCL4 upregulation was associated with increased Snail expression and downregulation of p53/PTEN in high-grade PIN and prostate cancer PMID: 23878190
  6. These results suggest that MIP-1beta is a novel key mediator, and the peripheral MIP-1beta-CCR5 axis contributes to neuropathic pain. PMID: 22528550
  7. results indicate that MIP-1beta is involved in the recruitment of bone marrow-derived monocyte lineage cells PMID: 21912378
  8. increased responsiveness of murine eosinophils to MIP-1beta is mediated by CCR5 receptor in mice PMID: 12050188
  9. macrophage inflammatory protein-1beta is a hypoxia-induced neutrophil survival factor. PMID: 15630139
  10. MIP-1beta is overexpressed, and VE-cadherin is underexpressed in heart transplant allografts compared with isografts PMID: 15897346
  11. Overproduction of MIP-1beta in chemokine (C-C motif) receptor 5-deficient mice after collagen II-immunization may contribute partially to the occurrence of arthritis PMID: 15967376
  12. The expression and role CXCL12 and CCL4 and their receptors (CXCR4 and CCR5) in regulating thymocyte migration in conjunction with extracellular matrix during acute T. cruzi infection are investigated. PMID: 16637021
  13. ATF3 appears to be part of a control mechanism that limits the amount of CCL4 released by macrophages, preventing excessive inflammation. PMID: 16982098
  14. Antibody neutralization of CCL4 abrogates the ability of T-cells from IL-4-treated NOD mice to transfer protection against type 1 diabetes. PMID: 17327452

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed