Recombinant Mouse C-C Motif Chemokine 4 (CCL4) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03454P

Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse C-C Motif Chemokine 4 (CCL4) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03454P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse C-C Motif Chemokine 4 (CCL4) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P14097 |
Target Symbol | CCL4 |
Synonyms | Ccl4; Mip1b; Scya4; C-C motif chemokine 4; Immune activation protein 2; ACT-2; ACT2; Macrophage inflammatory protein 1-beta; MIP-1-beta; Protein H400; SIS-gamma; Small-inducible cytokine A4 |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN |
Expression Range | 24-92aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 11.8 kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Monokine with inflammatory and chemokinetic properties. |
Subcellular Location | Secreted. |
Protein Families | Intercrine beta (chemokine CC) family |
Database References |
Gene Functions References
- CCL4-CCR5 axis can contribute to breast cancer metastasis to bone by mediating the interaction between cancer cells and fibroblasts in bone cavity. PMID: 27177471
- YY1 regulates lung CCL4 transcription in pulmonary tuberculosis. PMID: 26786659
- Ccl4 mRNAs increased within 5 h after injury in mouse cortical slices. PMID: 25895671
- CCL4 and CCL5 expression was higher in livers of infected WSX-1(-/-) mice than infected WT mice, and hepatic CD4 T cells from WSX-1(-/-) mice expressed higher levels of CCR5 than cells from WT mice PMID: 24244314
- CCL4 upregulation was associated with increased Snail expression and downregulation of p53/PTEN in high-grade PIN and prostate cancer PMID: 23878190
- These results suggest that MIP-1beta is a novel key mediator, and the peripheral MIP-1beta-CCR5 axis contributes to neuropathic pain. PMID: 22528550
- results indicate that MIP-1beta is involved in the recruitment of bone marrow-derived monocyte lineage cells PMID: 21912378
- increased responsiveness of murine eosinophils to MIP-1beta is mediated by CCR5 receptor in mice PMID: 12050188
- macrophage inflammatory protein-1beta is a hypoxia-induced neutrophil survival factor. PMID: 15630139
- MIP-1beta is overexpressed, and VE-cadherin is underexpressed in heart transplant allografts compared with isografts PMID: 15897346
- Overproduction of MIP-1beta in chemokine (C-C motif) receptor 5-deficient mice after collagen II-immunization may contribute partially to the occurrence of arthritis PMID: 15967376
- The expression and role CXCL12 and CCL4 and their receptors (CXCR4 and CCR5) in regulating thymocyte migration in conjunction with extracellular matrix during acute T. cruzi infection are investigated. PMID: 16637021
- ATF3 appears to be part of a control mechanism that limits the amount of CCL4 released by macrophages, preventing excessive inflammation. PMID: 16982098
- Antibody neutralization of CCL4 abrogates the ability of T-cells from IL-4-treated NOD mice to transfer protection against type 1 diabetes. PMID: 17327452