Recombinant Mouse C-X-C Motif Chemokine 11 (CXCL11) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08343P

Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse C-X-C Motif Chemokine 11 (CXCL11) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08343P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse C-X-C Motif Chemokine 11 (CXCL11) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q9JHH5 |
Target Symbol | CXCL11 |
Synonyms | Cxcl11; Scyb11C-X-C motif chemokine 11; Interferon-inducible T-cell alpha chemoattractant; I-TAC; Small-inducible cytokine B11 |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQ |
Expression Range | 22-98aa |
Protein Length | Partial |
Mol. Weight | 12.9kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses. |
Subcellular Location | Secreted. |
Protein Families | Intercrine alpha (chemokine CxC) family |
Database References |
Gene Functions References
- although the expression of CXCL9 and CXCL11 are increased after spinal nerve ligation, they may not contribute to the maintenance of neuropathic pain. PMID: 29712506
- These findings functionally integrate K17, hnRNP K, and gene expression along with RSK and CXCR3 signaling in a keratinocyte-autonomous axis and provide a potential basis for their implication in tumorigenesis PMID: 25713416
- very low doses of CXCL11 rapidly suppress signs of EAE in C57BL/6 mice lacking functional CXCL11. PMID: 24713654
- Data indicate that epidermis-derived I-TAC (Cxcl11) triggers a sustained Th2-response that determines the outcome of a complex immunological process. PMID: 24398292
- Analysis of genes within the Listr1 locus identified a frameshift mutation in the Cxcl11 gene of the C57BL/6 strain that prevents production of the mature chemokine CXCL11. PMID: 24566892
- Cxcl10 and cxcl11 are new hair-specific transcriptional targets of ectodysplasin, and they indicates involvement of chemokines in hair development. PMID: 22277947
- the CXCL11-heparin interaction has two different affinities for glycosaminoglycans PMID: 20363748
- I-TAC can have an important role during virus infections and vaccinia virus has evolved ways to avoid inducing I-TAC expression. PMID: 15030574
- I-TAC acts as an antagonist for CCR5. I-TAC inhibited the binding of macrophage-inflammatory protein-1alpha (MIP-1alpha)/CC chemokine ligand 3 (CCL3) to cells transfected with CCR5 and to monocytes. PMID: 15178708
- Acute ethanol intoxication impairs lung expression of Cxcl11, interfering with pulmonary response to bacterial challenge. PMID: 17889309
- homologous to human T cell attracting chemokine CXC receptor ligand 11; involved in calcium mobilization and chemotaxis PMID: 11500837