Recombinant Mouse C-X-C Motif Chemokine 14 (CXCL14) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08341P

Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse C-X-C Motif Chemokine 14 (CXCL14) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08341P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse C-X-C Motif Chemokine 14 (CXCL14) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q9WUQ5 |
Target Symbol | CXCL14 |
Synonyms | Cxcl14; Bmac; Kec; Ks1; Mip2g; Scyb14C-X-C motif chemokine 14; B-cell and monocyte-activating chemokine; Chemokine BRAK; Kidney-expressed chemokine CXC; MIP-2G; Small-inducible cytokine B14 |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE |
Expression Range | 23-99aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 13.4kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Chemotactic for CESS B-cells and THP-1 monocytes, but not T-cells. |
Subcellular Location | Secreted. |
Protein Families | Intercrine alpha (chemokine CxC) family |
Database References | |
Tissue Specificity | Highly expressed in brain, lung, ovary, muscle and in kidney and liver parenchyma, and at lower levels in bone marrow. |
Gene Functions References
- Platelets are a relevant source of CXCL14. Platelet-derived CXCL14 at the site of vascular lesions might play an important role in vascular repair/regeneration. PMID: 28359053
- CXCL14 Tg mice showed a suppressed rate of carcinogenesis, decreased tumour volume, and reduced pulmonary metastasis, as well as an increased survival rate of mice following tumour cell injection. PMID: 25765541
- CXCL14 does not seem to play a pivotal role during influenza and Escherichia coli infections of the lung. PMID: 25313607
- CXCL14 was able to promote bone metastasis through enhancement of cancer cell tropism to the bone and/or recruitment of bone marrow cells around metastatic cancer cells. PMID: 24534874
- In conclusion, our results suggested the important function of Cxcl14 in uNK cells and the proper level of Cxcl14 protein were required to recruit NK cells to pregnant uterus. PMID: 23688424
- the transient expression of CXCL14 by Purkinje cells in the developing cerebellum, suggesting that it must be involved in the postnatal maturation of the cerebellum PMID: 22843118
- CXCL14 may play an important role in central nervous system regulation of feeding behavior PMID: 20428232
- Study identifies CXCL14 as a novel marker of tendon connective tissue. PMID: 21038449
- Murine CXCL14 is dispensable for the homeostatic recruitment of antigen-presenting cells toward the periphery and for LC functionality. PMID: 17130243
- CXCL14 is a critical chemoattractant of white adipose tissue macrophages and a novel regulator of glucose metabolism that functions mainly in skeletal muscle. PMID: 17724031
- These results suggest that CXCL14 plays a causal role in high-fat diet-induced obesity. PMID: 17971304
- Data suggest that despite the structural homology and similarity in tissue distribution of human and murine CXCL14, distinct differences point to diverse, species-specific needs for CXCL14 in epithelial immunity. PMID: 18809336
- findings demonstrate that early overexpression of PMP22 in a mouse model of Charcot-Marie-Tooth disease type 1A results in a strong up-regulation of CXCL14 which seems to play a novel regulatory role in Schwann cell differentiation PMID: 19111616
- CXCL14 is an important paracrine/autocrine modulator regulating trophoblast outgrowth at the maternal-fetal interface during the process of pregnancy establishment. PMID: 19626669
- These data indicate the possibility that BRAK expression inhibits tumor cell establishment by regulating interactions between tumor stem cells and NK cells and/or suppressing formation of tumor microvessels. PMID: 19887729