Recombinant Mouse C-X-C Motif Chemokine 3 Protein (CXCL3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08345P

Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse C-X-C Motif Chemokine 3 Protein (CXCL3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08345P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse C-X-C Motif Chemokine 3 Protein (CXCL3) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q6W5C0 |
Target Symbol | CXCL3 |
Synonyms | Cxcl3; Dcip1; Gm1960C-X-C motif chemokine 3; Dendritic cell inflammatory protein 1 |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | SELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS |
Expression Range | 32-100aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 11.6kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Ligand for CXCR2. Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. |
Subcellular Location | Secreted. |
Protein Families | Intercrine alpha (chemokine CxC) family |
Database References |
Gene Functions References
- The studies revealed that, although overall structural and oligomerization features of CXCL3 and CXCL2 are similar, prominent differences were observed in their surface characteristics, thus implicating a functional divergence. PMID: 28928065
- these results have indicated that CXCL3 is a novel adipokine that facilitates adipogenesis in an autocrine and/or a paracrine manner through induction of c/ebpb and c/ebpd. PMID: 27512010
- Tis21 induces migration of cerebellar granule neuron precursor cells through Cxcl3, which may represent a novel target for medulloblastoma therapy PMID: 23115191
- DCIP-1 interacts with chemokine CXCR2 and mediates human neutrophil chemotaxis, consistent with its role during the early proinflammatory phase of dendritic cell maturation. PMID: 14764687