Recombinant Mouse CD101 Protein (Tagged)

Name: Recombinant Mouse CD101 Protein (Tagged)
Brand: Beta LifeScience
SKU: BLA-10809P
Availability: InStock

Collections: Cluster of differentiation (cd) proteins, Featured cd protein molecules, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Mouse
Accession	A8E0Y8
Synonym	CD101 molecule cell surface glycoprotein V7 EWI-101 glu-Trp-Ile EWI motif-containing protein 101 IGSF2 Immunoglobulin superfamily member 2 Leukocyte surface protein V7 V7 LSB
Description	Recombinant Mouse CD101 Protein (Tagged) was expressed in Mammalian. It is a Protein fragment
Source	Mammalian
AA Sequence	REVKIQEGPLYRAEGYPVSIRCTVSGHQGPSTQDFRWSIYLPSAPTKEVQ IISTKDAGFSYAVYAQRVQSKEIYIERLQGDSVLLHISKLQMKDAGEYEC HTPNTDGKYFGSYSAKTNLTVVPDTLSATMPSQTLSKKEGEPLELTCETT KATVQHTHLSLTWYLMQEGGGSQATEIVSLSKDFVLTPGSSYADRFVAGD VRLDKLGATSFRLSVGKLQPSDQGQVFCEATEWIQDPDETWTLIT
Molecular Weight	115 kDa
Purity	>85% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Plays a role as inhibitor of T-cells proliferation induced by CD3. Inhibits expression of IL2RA on activated T-cells and secretion of IL2. Inhibits tyrosine kinases that are required for IL2 production and cellular proliferation. Inhibits phospholipase C-gamma-1/PLCG1 phosphorylation and subsequent CD3-induced changes in intracellular free calcium. Prevents nuclear translocation of nuclear factor of activated T-cell to the nucleus. Plays a role in the inhibition of T-cell proliferation via IL10 secretion by cutaneous dendritic cells.
Subcellular Location	Membrane; Single-pass type I membrane protein.
Database References	KEGG: mmu:630146 STRING: 10090.ENSMUSP00000116643 UniGene: Mm.190915

Gene Functions References

CD101 inhibits the expansion of colitogenic T cells. PMID: 26813346
Further support is provided for the hypothesis that Cd101 is insulin-dependent diabetes susceptibility region 10 (Idd10); haplotype and expression analyses of novel Idd10 congenic strains are coupled to the development of a CD101 knockout mouse. PMID: 21613616
A gene region (Idd10) previously shown to influence susceptibility to type 1 diabetes in the NOD mouse also influences an autoimmune disease involving a different tissue, the liver, which follows an infection with Novosphingobium aromaticivorans. PMID: 21613619

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.